DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab26 and Rab9D

DIOPT Version :9

Sequence 1:NP_001097658.1 Gene:Rab26 / 40359 FlyBaseID:FBgn0086913 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_727432.1 Gene:Rab9D / 318149 FlyBaseID:FBgn0067052 Length:197 Species:Drosophila melanogaster


Alignment Length:198 Identity:71/198 - (35%)
Similarity:112/198 - (56%) Gaps:6/198 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   208 EFDIMGKVIMLGDSGVGKTSLLIRFRDGRYVPSYFLSTVGIDFRNKVVVVDGTRV--KLQIWDTA 270
            ::|...|:|:|||||||||.||:||.|.::...: .||||:|.|...|.....|:  .||:|||:
  Fly     3 QYDNPFKIILLGDSGVGKTCLLMRFSDNQFTTRH-RSTVGLDRRECSVEFADWRMGRMLQVWDTS 66

  Fly   271 GQERFRSVTHAYYRDAHALLLLYDVTNKTTYDNIRAWLGEIREYAQEDVVIVLIGNKADCSGSER 335
            ..|||:.:.....|.||.:||:||:|:..::.||..|:.|||....:.|:::|:|||:| ..:.|
  Fly    67 DDERFKLLKATQCRSAHGILLVYDITSSKSFQNIDGWMKEIRRLCPDKVIVLLVGNKSD-DPNHR 130

  Fly   336 QVKREDGERLGREHNVPFMETSAKTGLNVELSFTAVARQLKSRGYEHGDDGKFNVHDFVRDNTKA 400
            ||....|.......::.|.|.|||:|.||...|:::|..:.:  |.......|::..:..:...|
  Fly   131 QVSMAQGFNYAHRQSICFEEVSAKSGRNVYDIFSSLAMDIYT--YRRVHYNPFSLTSWQEEEDAA 193

  Fly   401 RSV 403
            .|:
  Fly   194 ESL 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab26NP_001097658.1 Rab26 214..407 CDD:206695 70/192 (36%)
RAB 214..378 CDD:197555 66/165 (40%)
Rab9DNP_727432.1 RAB 8..171 CDD:197555 66/164 (40%)
Rab 8..167 CDD:206640 65/160 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454296
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.