Sequence 1: | NP_001097658.1 | Gene: | Rab26 / 40359 | FlyBaseID: | FBgn0086913 | Length: | 410 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_726743.1 | Gene: | Rab27 / 31103 | FlyBaseID: | FBgn0025382 | Length: | 236 | Species: | Drosophila melanogaster |
Alignment Length: | 234 | Identity: | 88/234 - (37%) |
---|---|---|---|
Similarity: | 133/234 - (56%) | Gaps: | 28/234 - (11%) |
- Green bases have known domain annotations that are detailed below.
Fly 202 APEEEDEFDIMG---KVIMLGDSGVGKTSLLIRFRDGRYVPSYFLSTVGIDFRNKVVVVDGT--- 260
Fly 261 -RVKLQIWDTAGQERFRSVTHAYYRDAHALLLLYDVTNKTTYDNIRAWLGEIREYA-QEDVVIVL 323
Fly 324 IGNKADCSGSERQVKREDGERLGREHNVPFMETSAKTGLNVELSFTAVARQLKSRGYEHGDDGKF 388
Fly 389 NV----------------HDFVRDNTKARSVCAQ--CRN 409 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Rab26 | NP_001097658.1 | Rab26 | 214..407 | CDD:206695 | 81/215 (38%) |
RAB | 214..378 | CDD:197555 | 75/168 (45%) | ||
Rab27 | NP_726743.1 | P-loop_NTPase | 19..187 | CDD:304359 | 75/169 (44%) |
RAB | 20..186 | CDD:197555 | 75/167 (45%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C45454470 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.930 |