DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab26 and Rab27

DIOPT Version :9

Sequence 1:NP_001097658.1 Gene:Rab26 / 40359 FlyBaseID:FBgn0086913 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_726743.1 Gene:Rab27 / 31103 FlyBaseID:FBgn0025382 Length:236 Species:Drosophila melanogaster


Alignment Length:234 Identity:88/234 - (37%)
Similarity:133/234 - (56%) Gaps:28/234 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   202 APEEEDEFDIMG---KVIMLGDSGVGKTSLLIRFRDGRYVPSYFLSTVGIDFRNKVVVVDGT--- 260
            ||.|.:...:.|   :.::|||||||||.||.::.|||: .:.|:||||||||.|.::.:..   
  Fly     4 APPEPEPLQLAGSGEQFLVLGDSGVGKTCLLYQYTDGRF-HTQFISTVGIDFREKRLLYNSRGRR 67

  Fly   261 -RVKLQIWDTAGQERFRSVTHAYYRDAHALLLLYDVTNKTTYDNIRAWLGEIREYA-QEDVVIVL 323
             |:.||||||||||||||:|.|:||||...||::|:|::.::.....||.::|.:| .||..:||
  Fly    68 HRIHLQIWDTAGQERFRSLTTAFYRDAMGFLLIFDLTSEKSFLETANWLSQLRTHAYSEDPDVVL 132

  Fly   324 IGNKADCSGSERQVKREDGERLGREHNVPFMETSAKTGLNVELSFTAVARQLKSRGYEHGDDGKF 388
            .|||.|.. ..|.|.|:....|.|.:.:|::||||.||.||:.:...:..::..|......:.:|
  Fly   133 CGNKCDLL-QLRVVSRDQVAALCRRYRLPYIETSACTGANVKEAVELLVGRVMERIENAACNREF 196

  Fly   389 NV----------------HDFVRDNTKARSVCAQ--CRN 409
            ::                .|.||.:.:....|::  |||
  Fly   197 SLLLTQSRCLPNIAYGQPEDLVRLHDRREEPCSRRNCRN 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab26NP_001097658.1 Rab26 214..407 CDD:206695 81/215 (38%)
RAB 214..378 CDD:197555 75/168 (45%)
Rab27NP_726743.1 P-loop_NTPase 19..187 CDD:304359 75/169 (44%)
RAB 20..186 CDD:197555 75/167 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454470
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.