DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab26 and RAB26

DIOPT Version :9

Sequence 1:NP_001097658.1 Gene:Rab26 / 40359 FlyBaseID:FBgn0086913 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_055168.2 Gene:RAB26 / 25837 HGNCID:14259 Length:256 Species:Homo sapiens


Alignment Length:267 Identity:140/267 - (52%)
Similarity:181/267 - (67%) Gaps:29/267 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   143 SATEQQPLLDSGGGV----SATAVARPPVAP-APVAPGPGSEGASATLCKNAGRALIRMISSSKA 202
            ::|.....|.:..|.    |.||::.|...| .|:.||..|.|...                   
Human    12 ASTPAASTLPTANGARPARSGTALSGPDAPPNGPLQPGRPSLGGGV------------------- 57

  Fly   203 PEEEDEFDIMGKVIMLGDSGVGKTSLLIRFRDGRYVPSYFLSTVGIDFRNKVVVVDGTRVKLQIW 267
                |.:|:..||:::||||||||.||:||:||.::...|:|||||||||||:.|||.:||||:|
Human    58 ----DFYDVAFKVMLVGDSGVGKTCLLVRFKDGAFLAGTFISTVGIDFRNKVLDVDGVKVKLQMW 118

  Fly   268 DTAGQERFRSVTHAYYRDAHALLLLYDVTNKTTYDNIRAWLGEIREYAQEDVVIVLIGNKADCSG 332
            |||||||||||||||||||||||||||||||.::|||:|||.||.||||.||.::|:|||.| |.
Human   119 DTAGQERFRSVTHAYYRDAHALLLLYDVTNKASFDNIQAWLTEIHEYAQHDVALMLLGNKVD-SA 182

  Fly   333 SERQVKREDGERLGREHNVPFMETSAKTGLNVELSFTAVARQLKSRGYEHGDDGKFNVHDFVRDN 397
            .||.|||||||:|.:|:.:|||||||||||||:|:|||:|::||.|..:...:.:|.:||:|:..
Human   183 HERVVKREDGEKLAKEYGLPFMETSAKTGLNVDLAFTAIAKELKQRSMKAPSEPRFRLHDYVKRE 247

  Fly   398 TKARSVC 404
            .:..|.|
Human   248 GRGASCC 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab26NP_001097658.1 Rab26 214..407 CDD:206695 125/191 (65%)
RAB 214..378 CDD:197555 118/163 (72%)
RAB26NP_055168.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..51 11/38 (29%)
Rab26 64..254 CDD:206695 124/190 (65%)
Effector region. /evidence=ECO:0000250 93..101 6/7 (86%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 236 1.000 Domainoid score I2345
eggNOG 1 0.900 - - E1_KOG0083
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H25655
Inparanoid 1 1.050 249 1.000 Inparanoid score I3245
Isobase 1 0.950 - 0 Normalized mean entropy S548
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1018397at2759
OrthoFinder 1 1.000 - - FOG0004377
OrthoInspector 1 1.000 - - otm41768
orthoMCL 1 0.900 - - OOG6_106826
Panther 1 1.100 - - LDO PTHR47978
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X3102
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1413.780

Return to query results.
Submit another query.