DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab26 and spg1

DIOPT Version :9

Sequence 1:NP_001097658.1 Gene:Rab26 / 40359 FlyBaseID:FBgn0086913 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_593285.1 Gene:spg1 / 2542761 PomBaseID:SPAC1565.06c Length:198 Species:Schizosaccharomyces pombe


Alignment Length:167 Identity:50/167 - (29%)
Similarity:84/167 - (50%) Gaps:16/167 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   214 KVIMLGDSGVGKTSLLIRFRDGRYVPSYFLSTVGIDFRNKVVVVDGTRVKLQIWDTAGQERFRSV 278
            ||.|:|||.:|||||::.:..|.: ......|:|::|..|.:.:..|.:...|||..||..|.::
pombe    12 KVGMIGDSSIGKTSLMVTYVQGSF-DEESTQTLGVNFMEKTISIRNTEITFSIWDLGGQREFVNM 75

  Fly   279 THAYYRDAHALLLLYDVTNKTTYDNIRAWLGEIREYAQEDVVIVLIGNKADCSGSERQVKREDGE 343
            ......||.|:|.::|::.|:|.::|:.|..:.|.: .:..|.:|||.|.|   ......|||.|
pombe    76 LPMVCNDAVAILFMFDLSRKSTLNSIKEWYRQARGF-NKTAVPILIGTKYD---HFMTFPREDQE 136

  Fly   344 RLGRE---------HNVPFMETSAKTGLNVELSFTAV 371
            .:.::         .::.|..||  ..:||:..|..|
pombe   137 EITKQARRYAKAMKASLVFCSTS--HSINVQKIFKIV 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab26NP_001097658.1 Rab26 214..407 CDD:206695 50/167 (30%)
RAB 214..378 CDD:197555 50/167 (30%)
spg1NP_593285.1 Spg1 11..192 CDD:206701 50/167 (30%)
Ras 12..177 CDD:278499 50/167 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.