DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab26 and Rab26

DIOPT Version :9

Sequence 1:NP_001097658.1 Gene:Rab26 / 40359 FlyBaseID:FBgn0086913 Length:410 Species:Drosophila melanogaster
Sequence 2:XP_038941050.1 Gene:Rab26 / 171111 RGDID:620890 Length:328 Species:Rattus norvegicus


Alignment Length:339 Identity:119/339 - (35%)
Similarity:161/339 - (47%) Gaps:111/339 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   154 GGGVSATA----------VARPPVA-PAPVAP--GPGSEGASATLCKNAGRALIRMISSSKAPEE 205
            ||.|.|.:          :|.|..| |.|.||  ||...|..:.    .|..             
  Rat    11 GGSVPAASTLPAAANGPRLAHPRTARPGPEAPPNGPPQSGRPSL----GGTG------------- 58

  Fly   206 EDEFDIMGKVIMLGDSGVGKTSLLIRFRDGRYVPSYFLSTVGIDFRNKVVVVDGTRVKLQIWDTA 270
             |.:|:..||:::||||||||.||:||:||.::...|:|||||||||||:.|||.:|||||||||
  Rat    59 -DFYDVAFKVMLVGDSGVGKTCLLVRFKDGAFLAGTFISTVGIDFRNKVLDVDGMKVKLQIWDTA 122

  Fly   271 GQERFRSVTHAYYRDAHALLLLYDVTNKTTYDNIRAWLGEIREYAQEDVVIV------------- 322
            |||||||||||||||||.:..|..|::     .:.|.....:.:.::...:|             
  Rat   123 GQERFRSVTHAYYRDAHGVSSLLSVSS-----TVAALRHHQQRFLRQHPGLVDRNPGICPAGRGA 182

  Fly   323 ------------------------LIGNKADCSG-----SERQVKREDGERLGR----------- 347
                                    |...|:.|.|     .||.|||||||:|.:           
  Rat   183 HAVGEQGGNLGQSSPSWPHRACHGLALTKSLCLGQVDSTQERVVKREDGEKLAKVSQNREGEEGL 247

  Fly   348 ----------------------EHNVPFMETSAKTGLNVELSFTAVARQLKSRGYEHGDDGKFNV 390
                                  |:.:||||||||:||||:|:|||:|::||.|..:...:.:|.:
  Rat   248 LEIVTLGPPPYAQHLAGSSYLQEYGLPFMETSAKSGLNVDLAFTAIAKELKQRSTKAPSEPRFRL 312

  Fly   391 HDFVRDNTKARSVC 404
            ||:|:...:..|.|
  Rat   313 HDYVKREGRGVSCC 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab26NP_001097658.1 Rab26 214..407 CDD:206695 102/266 (38%)
RAB 214..378 CDD:197555 95/238 (40%)
Rab26XP_038941050.1 P-loop_NTPase 65..326 CDD:422963 103/272 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 237 1.000 Domainoid score I2243
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H25655
Inparanoid 1 1.050 249 1.000 Inparanoid score I3156
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1018397at2759
OrthoFinder 1 1.000 - - FOG0004377
OrthoInspector 1 1.000 - - otm45900
orthoMCL 1 0.900 - - OOG6_106826
Panther 1 1.100 - - LDO PTHR47978
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X3102
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1110.970

Return to query results.
Submit another query.