DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab26 and LOC101885697

DIOPT Version :9

Sequence 1:NP_001097658.1 Gene:Rab26 / 40359 FlyBaseID:FBgn0086913 Length:410 Species:Drosophila melanogaster
Sequence 2:XP_021326485.1 Gene:LOC101885697 / 101885697 -ID:- Length:201 Species:Danio rerio


Alignment Length:193 Identity:105/193 - (54%)
Similarity:140/193 - (72%) Gaps:3/193 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   214 KVIMLGDSGVGKTSLLIRFRDGRYVPSYFLSTVGIDFRNKVVVVDGTRV--KLQIWDTAGQERFR 276
            :.|::|||||||||||::|..|:::|..|.:||||.|.......:.|.:  ..||||||||||||
Zfish     8 QTILVGDSGVGKTSLLVQFDQGKFIPGSFSATVGIGFTEYSHTHNHTDILCVCQIWDTAGQERFR 72

  Fly   277 SVTHAYYRDAHALLLLYDVTNKTTYDNIRAWLGEIREYAQEDVVIVLIGNKADCSGSERQVKRED 341
            ||||||||||.|||||||:|:|:::||.||||.||.||||:||||:|:|||:|.| |.|.::|||
Zfish    73 SVTHAYYRDAQALLLLYDITSKSSFDNTRAWLTEIHEYAQDDVVIMLLGNKSDMS-SSRVIRRED 136

  Fly   342 GERLGREHNVPFMETSAKTGLNVELSFTAVARQLKSRGYEHGDDGKFNVHDFVRDNTKARSVC 404
            ||:|.||:.|.|:||||||||||:.:|..|.::|..|..:...:..|::||.:....:....|
Zfish   137 GEKLAREYGVIFLETSAKTGLNVDEAFMTVGKELVRRAVQLPVEPTFHLHDVMEPQKETSGCC 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab26NP_001097658.1 Rab26 214..407 CDD:206695 105/193 (54%)
RAB 214..378 CDD:197555 100/165 (61%)
LOC101885697XP_021326485.1 Rab26 8..199 CDD:206695 104/191 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170594732
Domainoid 1 1.000 213 1.000 Domainoid score I2706
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1018397at2759
OrthoFinder 1 1.000 - - FOG0004377
OrthoInspector 1 1.000 - - oto39894
orthoMCL 1 0.900 - - OOG6_106826
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X3102
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
87.750

Return to query results.
Submit another query.