DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pc and Cbx7

DIOPT Version :9

Sequence 1:NP_524199.1 Gene:Pc / 40358 FlyBaseID:FBgn0003042 Length:390 Species:Drosophila melanogaster
Sequence 2:XP_006521207.1 Gene:Cbx7 / 52609 MGIID:1196439 Length:251 Species:Mus musculus


Alignment Length:378 Identity:91/378 - (24%)
Similarity:126/378 - (33%) Gaps:156/378 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 VYAAEKIIQKRVKKGVVEYRVKWKGWNQRYNTWEPEVNILDRRLIDIYEQTNKSSGTPSKRGIKK 89
            |:|.|.|.:|||:||.|||.||||||..:|:|||||.:|||.||:..||                
Mouse    10 VFAVESIRKKRVRKGKVEYLVKWKGWPPKYSTWEPEEHILDPRLVMAYE---------------- 58

  Fly    90 KEKEPDPEPESEEDEYTFTENDVDTHQATTSSATHDKESKKEKKHHHHHHHHHHIKSERNSGRRS 154
             |||                                                   :.:|.||.|.
Mouse    59 -EKE---------------------------------------------------ERDRASGYRK 71

  Fly   155 ESPLTHHHHHHHHESKRQRIDHSSSSNSSFTHNSFVPEPDSNSSSS-----------EDQPLIGT 208
            ..|...........|...|..|.:..|.....:  :..|..:.|..           |..||:.|
Mouse    72 RGPKPRRLLLQRLYSMDLRSSHKAKGNEKLCFS--LARPLRSGSPMGVVKAGVAELVEKGPLVPT 134

  Fly   209 -------KRKA-EVLKESGKIGVTIKTSPDGPTIKPQPTQQVTPSQQQPFQDQQQAEKIASEAAT 265
                   .||| :.|:.|.|     |..|.||.::....::                        
Mouse   135 LPFPLRKARKAHKYLRLSRK-----KFPPRGPHLESHSHRR------------------------ 170

  Fly   266 QLKSEQQATPLATEAINTTPAESGAEEEEVANEEGNQQAPQVPSENNNIPKPCNNLAINQKQPLT 330
            :|..::.|.|...:    ||.:          .|..:|||:..:|.:         ..|...|.|
Mouse   171 ELSLQESAAPDVVQ----TPGD----------WEPMEQAPEEEAEAD---------LTNGPPPWT 212

  Fly   331 PLSPRALPPRFWLPAKCNISNRVVITDVTVNLETVTIRECKTERGFFRERDMK 383
            |..|               |:.|.:||:|.|..|||.||.:...||||:|:.|
Mouse   213 PTLP---------------SSEVTVTDITANSVTVTFREAQAAEGFFRDRNEK 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PcNP_524199.1 CHROMO 25..77 CDD:214605 31/51 (61%)
Cbx7XP_006521207.1 CD_Cbx7 7..62 CDD:349293 34/119 (29%)
CBX7_C 209..240 CDD:375056 15/45 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 71 1.000 Domainoid score I9385
eggNOG 1 0.900 - - E1_KOG2748
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 124 1.000 Inparanoid score I4687
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1628171at2759
OrthoFinder 1 1.000 - - FOG0000191
OrthoInspector 1 1.000 - - otm43469
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2447
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
109.860

Return to query results.
Submit another query.