DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pc and Cbx4

DIOPT Version :9

Sequence 1:NP_524199.1 Gene:Pc / 40358 FlyBaseID:FBgn0003042 Length:390 Species:Drosophila melanogaster
Sequence 2:XP_008766707.2 Gene:Cbx4 / 501403 RGDID:1587243 Length:551 Species:Rattus norvegicus


Alignment Length:358 Identity:86/358 - (24%)
Similarity:135/358 - (37%) Gaps:59/358 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 VYAAEKIIQKRVKKGVVEYRVKWKGWNQRYNTWEPEVNILDRRLIDIYEQTNKSSGTPSKRGIKK 89
            |:|.|.|.:||::||.|||.|||:||:.:|||||||.||||.||:..::...:..   ...|.:|
  Rat    10 VFAVESIEKKRIRKGRVEYLVKWRGWSPKYNTWEPEENILDPRLLIAFQNRERQE---QLMGYRK 71

  Fly    90 KEKEPDP----EPESEEDEYTFT-------ENDVDTHQATTSSATHDKESKKEKKHHHHHHHHHH 143
            :..:|.|    .|.........|       :|.......|.......:.....||||.:..|   
  Rat    72 RGPKPKPLVVQVPTFARRSNVLTGLQDSSADNRAKLELGTQGKGQGHQYELNSKKHHQYQPH--- 133

  Fly   144 IKSERN--------SGRRSESPLTHHHHHHHHESKRQRIDHSSSSNSSFTHNSFVPEPDSNSSSS 200
             ..||:        ||:......:..||.:..:.|...:.:..|...:       |.|......:
  Rat   134 -GKERSGKPPPPGKSGKYYYQLNSKKHHPYQPDPKMYDLQYQGSHKEA-------PSPTCPDLGA 190

  Fly   201 EDQP----LIGTKRK---AEVLKESGKIGVTIKTSPDGPT--IKPQPTQQVTPS----QQQPFQD 252
            :..|    ..|...|   ..|....|..|...|.|..||.  :.|.|.:.|..:    :.:..::
  Rat   191 KSHPPDKWAHGAAAKGYLGAVKPLGGGAGAPGKGSEKGPPNGLTPAPKEAVAGNGIGGKMKIVKN 255

  Fly   253 QQQAEKIASEAATQLKSEQQATPLATEAINTTPAESGAEEEEVANEEGNQQAPQV------PSEN 311
            :.:..:|....:..:::..||..:.:.....:.|.|.:.::..| ||.:.||.:.      .||.
  Rat   256 KNKNGRIVIVMSKYMENGMQAVKIKSGEAAESEARSPSHKKRAA-EERHPQADRTFKKAAGASEE 319

  Fly   312 NNIPKPCNN-----LAINQKQPLTPLSPRALPP 339
            .....||..     |.....|| ..|..|.|.|
  Rat   320 KKAEVPCKRREEEALVSGDPQP-QDLGSRKLSP 351

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PcNP_524199.1 CHROMO 25..77 CDD:214605 29/51 (57%)
Cbx4XP_008766707.2 CD_Cbx4 8..62 CDD:349292 29/51 (57%)
CBX7_C <529..550 CDD:407338
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 71 1.000 Domainoid score I9195
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 124 1.000 Inparanoid score I4621
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1628171at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm45533
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
55.060

Return to query results.
Submit another query.