DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pc and cbx7

DIOPT Version :9

Sequence 1:NP_524199.1 Gene:Pc / 40358 FlyBaseID:FBgn0003042 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_001005071.1 Gene:cbx7 / 448638 XenbaseID:XB-GENE-942584 Length:245 Species:Xenopus tropicalis


Alignment Length:359 Identity:86/359 - (23%)
Similarity:120/359 - (33%) Gaps:130/359 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 VYAAEKIIQKRVKKGVVEYRVKWKGWNQRYNTWEPEVNILDRRLIDIYEQTNKSSGTPSKRGIKK 89
            |:|.|.|.:||::||.|||.||||||..:|:|||||.:|||.||:..||:               
 Frog    10 VFAVESIRKKRIRKGKVEYLVKWKGWPPKYSTWEPEEHILDPRLVLAYEE--------------- 59

  Fly    90 KEKEPDPEPESEEDEYTFTENDVDTHQATTSSATHDKESKKEKKHHHHHHHHHHIKSERNSGRRS 154
                                                    ||:|             ||.||.|.
 Frog    60 ----------------------------------------KEEK-------------ERASGCRK 71

  Fly   155 ESPLTHHHHHHHHESKRQRIDHSSSSNSSFTHNSFVPEPDSN---SSSSEDQPLIGTKRKAEVLK 216
            ..|          :.||..:....|.:....|.|    .:.|   |.|....|.:|         
 Frog    72 RGP----------KPKRLLLQRLYSMDLRSAHKS----KERNLCFSLSRRFNPALG--------- 113

  Fly   217 ESGKIGVTIKTSPDGPTIKPQPTQQVTPSQQQPFQDQQQAEKIASEAATQLKSEQQATPLATEAI 281
                          |.|.......:...|.|.|...|::..|....:..:........||:..:.
 Frog   114 --------------GKTTPTSSVPEKAKSLQFPLSKQRKGRKFLCLSRKKFLRVSTYEPLSRRSD 164

  Fly   282 NTTPAESGAEEEEVANEEGNQQAPQVPSENNNIPKPCNNLAINQKQPLTPLSPRALPPRFWLPAK 346
            .....|...|.|.:.:.:..:...:...|.|..|                    |.|| .||||.
 Frog   165 FFAKEEEKEETETIPDWQEEKSMEEQGLEENGTP--------------------ATPP-LWLPAV 208

  Fly   347 CNISNRVVITDVTVNLETVTIRECKTERGFFRER 380
            ...| .:::||:|.|..|||.||.::..||||:|
 Frog   209 PRPS-EIIVTDITSNSITVTFREARSAEGFFRDR 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PcNP_524199.1 CHROMO 25..77 CDD:214605 30/51 (59%)
cbx7NP_001005071.1 CD_Cbx7 7..62 CDD:349293 31/106 (29%)
CBX7_C 202..234 CDD:375056 15/33 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 70 1.000 Domainoid score I9355
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 121 1.000 Inparanoid score I4605
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1628171at2759
OrthoFinder 1 1.000 - - FOG0000191
OrthoInspector 1 1.000 - - otm48625
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2447
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
66.090

Return to query results.
Submit another query.