DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Pc and HP1c

DIOPT Version :9

Sequence 1:	NP_524199.1	Gene:	Pc / 40358	FlyBaseID:	FBgn0003042	Length:	390	Species:	Drosophila melanogaster
Sequence 2:	NP_651093.1	Gene:	HP1c / 42696	FlyBaseID:	FBgn0039019	Length:	237	Species:	Drosophila melanogaster

Alignment Length:	78	Identity:	30/78 - (38%)
Similarity:	42/78 - (53%)	Gaps:	12/78 - (15%)

- Green bases have known domain annotations that are detailed below.

  Fly    26 YAAEKIIQKRV-KKGVVEYRVKWKGWNQRYNTWEPEVNILDRRLIDIYEQTNKSSGTPSKRGIKK 89
            :..|:|:.||: .:|.|||.:||:|:....||||||.|.....||..:|::...|   .|||.||
  Fly     8 FVVERIMDKRITSEGKVEYYIKWRGYTSADNTWEPEENCDCPNLIQKFEESRAKS---KKRGEKK 69

  Fly    90 KEKEPDPEPESEE 102
                    |:.||
  Fly    70 --------PKCEE 74

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Pc	NP_524199.1	CHROMO	25..77	CDD:214605	21/51 (41%)
HP1c	NP_651093.1	Chromo	9..58	CDD:278797	21/48 (44%)
HP1c	NP_651093.1	Chromo_shadow	89..134	CDD:279701
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	1	1.010	-	-		D1628171at2759
OrthoFinder	1	1.000	-	-		FOG0000191
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
	3	2.920