DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Pc and HP1e

DIOPT Version :9

Sequence 1:	NP_524199.1	Gene:	Pc / 40358	FlyBaseID:	FBgn0003042	Length:	390	Species:	Drosophila melanogaster
Sequence 2:	NP_649878.1	Gene:	HP1e / 41108	FlyBaseID:	FBgn0037675	Length:	174	Species:	Drosophila melanogaster

Alignment Length:	90	Identity:	29/90 - (32%)
Similarity:	42/90 - (46%)	Gaps:	13/90 - (14%)

- Green bases have known domain annotations that are detailed below.

  Fly    15 DNATDDPVDLVYAAEKIIQKRVKKGVVEYRVKWKGWNQRYNTWEPEVNILDRRLIDIYEQTNKSS 79
            :|:||......|..|:|:.:|...|.::|.|||..::...||||...::....|||..| :.||
  Fly    16 ENSTDFEETEEYIVERILDRRHYMGQLQYLVKWLDYSDEDNTWESAADLDCHSLIDSIE-SQKS- 78

  Fly    80 GTPSKRG--------IKKKEKEPDP 96
               .|||        .|.|..:.||
  Fly    79 ---LKRGQELNNQYETKAKRLKIDP 100

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Pc	NP_524199.1	CHROMO	25..77	CDD:214605	17/51 (33%)
HP1e	NP_649878.1	CHROMO	25..67	CDD:237991	13/41 (32%)
HP1e	NP_649878.1	Chromo_shadow	113..164	CDD:279701
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	1	1.010	-	-		D1628171at2759
OrthoFinder	1	1.000	-	-		FOG0000191
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
	3	2.920