DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pc and HP6

DIOPT Version :10

Sequence 1:NP_524199.1 Gene:Pc / 40358 FlyBaseID:FBgn0003042 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_608842.1 Gene:HP6 / 33661 FlyBaseID:FBgn0031613 Length:106 Species:Drosophila melanogaster


Alignment Length:70 Identity:15/70 - (21%)
Similarity:30/70 - (42%) Gaps:18/70 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 GVVEYRVKWKGWNQR-------YNTWEPE--VNILDRRLI-------DIYEQTNKSSGTPSKRGI 87
            |.:.:.::|||.::.       .|...|:  ::..:.|::       :..|..|....|||.|  
  Fly    37 GKLTFLMQWKGCDEAGLVPAEVLNVRCPQMVISFYEERIVFTDEGDEEDLESDNGYETTPSPR-- 99

  Fly    88 KKKEK 92
            ||:.:
  Fly   100 KKRSR 104

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PcNP_524199.1 CD_polycomb 23..76 CDD:349291 8/52 (15%)
CBX7_C 341..373 CDD:465385
HP6NP_608842.1 CSD 24..75 CDD:349275 6/37 (16%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.