DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pc and HP1D3csd

DIOPT Version :10

Sequence 1:NP_524199.1 Gene:Pc / 40358 FlyBaseID:FBgn0003042 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_573358.1 Gene:HP1D3csd / 32906 FlyBaseID:FBgn0030994 Length:179 Species:Drosophila melanogaster


Alignment Length:186 Identity:43/186 - (23%)
Similarity:74/186 - (39%) Gaps:47/186 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 NKSS-GTPSKRGIKKKEKEPDPEPESEEDEYTFTEND--VDTHQATTSSATHDKESKKEKKHHHH 137
            ||:: |.|::   ::|:||.|.:.|:::.:    |||  .:..:..|...:.:..|....||...
  Fly    10 NKNTGGFPAE---EEKQKENDQQKENDQQK----ENDQQEEVQEEPTKDESKEAGSTPPPKHMGV 67

  Fly   138 HHHHHHIKSERNSGRRSESPLTHHHHHHHHESKRQRIDHSSSSNSSFTHNSFVPEPDSNSSSSED 202
            |          ||.|...:.|.       .|...|:.:..:::..|.:.|.      ...:|:|.
  Fly    68 H----------NSARAELARLL-------VELLVQQAELDATNGGSVSGNL------DGGNSNES 109

  Fly   203 QPL-------IGTKRKA-EVLKESGKIG------VTIKTSPDGPTIKPQPTQQVTP 244
            |||       :..:.|| |.:..|..:|      ||.|.|..|..:..|..:.|.|
  Fly   110 QPLNVPPTDALLVRGKAIENVMYSYMLGDTVYFIVTWKGSKWGEAVPVQEIKHVHP 165

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PcNP_524199.1 CD_polycomb 23..76 CDD:349291 43/186 (23%)
CBX7_C 341..373 CDD:465385
HP1D3csdNP_573358.1 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.