DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pc and CG8289

DIOPT Version :9

Sequence 1:NP_524199.1 Gene:Pc / 40358 FlyBaseID:FBgn0003042 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_573229.1 Gene:CG8289 / 32741 FlyBaseID:FBgn0030854 Length:336 Species:Drosophila melanogaster


Alignment Length:191 Identity:40/191 - (20%)
Similarity:68/191 - (35%) Gaps:78/191 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 KGSKGKLGRDNA----TDDPVD--LVYAAEKIIQKRVKKGVVEYRVKWKGWNQRYNTWEPEVNIL 64
            |.:||: ||.||    .||.:|  ..:..|||:.....|....::::||.:..:.::|||..|:.
  Fly   208 KKAKGR-GRRNAGTKKADDSIDPEKQWEVEKILDHVATKEGDMFKIRWKKYGPKDDSWEPSKNLA 271

  Fly    65 DRRLIDIYEQTNKSSGTPSKRGIKKKEKEPDPEPESEEDEYTFTENDVDTHQATTSSATHDKESK 129
            ...||:.:              ::|:.                |:.:||                
  Fly   272 CDALIEKF--------------MRKQA----------------TQENVD---------------- 290

  Fly   130 KEKKHHHHHHHHHHIKSERNSGRRSES------PLTHHHHHHHHESKRQRIDHSSSSNSSF 184
                          :|..|.|.:::|.      |.|:.|:.....|||     ||:.|..|
  Fly   291 --------------VKELRESPKKTERLVDECYPRTNLHNRIERSSKR-----SSAKNRIF 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PcNP_524199.1 CHROMO 25..77 CDD:214605 12/51 (24%)
CG8289NP_573229.1 CHROMO 233..284 CDD:214605 13/64 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1628171at2759
OrthoFinder 1 1.000 - - FOG0000191
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.