DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pc and Cbx3

DIOPT Version :9

Sequence 1:NP_524199.1 Gene:Pc / 40358 FlyBaseID:FBgn0003042 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_001008314.2 Gene:Cbx3 / 297093 RGDID:1549705 Length:183 Species:Rattus norvegicus


Alignment Length:127 Identity:36/127 - (28%)
Similarity:56/127 - (44%) Gaps:28/127 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 KGSKGKLGRDNATDDPVDLVYAAEKIIQKRVKKGVVEYRVKWKGWNQRYNTWEPEVNILDRRLID 70
            |..|.:.|:....::.....:..||::.:||..|.|||.:||||:....||||||.|:....||:
  Rat    10 KMGKKQNGKSKKVEEAEPEEFVVEKVLDRRVVNGKVEYFLKWKGFTDADNTWEPEENLDCPELIE 74

  Fly    71 IYEQTNKSSGTPSKRGIKKKEKEPDPEPESEEDEYTFTENDVDTHQATTSSATHDKESKKEK 132
            .:..:.|:.  ..|.|.|:|...     :||.|                     |.:|||::
  Rat    75 AFLNSQKAG--KEKDGTKRKSLS-----DSESD---------------------DSKSKKKR 108

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PcNP_524199.1 CHROMO 25..77 CDD:214605 21/51 (41%)
Cbx3NP_001008314.2 CD_HP1gamma_Cbx3 29..78 CDD:349299 21/48 (44%)
CSD_HP1gamma_Cbx3 116..173 CDD:349303
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1628171at2759
OrthoFinder 1 1.000 - - FOG0000191
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.