DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pc and CBX7

DIOPT Version :9

Sequence 1:NP_524199.1 Gene:Pc / 40358 FlyBaseID:FBgn0003042 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_783640.1 Gene:CBX7 / 23492 HGNCID:1557 Length:251 Species:Homo sapiens


Alignment Length:387 Identity:98/387 - (25%)
Similarity:128/387 - (33%) Gaps:174/387 - (44%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 VYAAEKIIQKRVKKGVVEYRVKWKGWNQRYNTWEPEVNILDRRLIDIYEQTNKSSGTPSKRGIKK 89
            |:|.|.|.:|||:||.|||.||||||..:|:|||||.:|||.||:..||                
Human    10 VFAVESIRKKRVRKGKVEYLVKWKGWPPKYSTWEPEEHILDPRLVMAYE---------------- 58

  Fly    90 KEKEPDPEPESEEDEYTFTENDVDTHQATTSSATHDKESKKEKKHHHHHHHHHHIKSERNSGRRS 154
             |||                                                   :.:|.||.|.
Human    59 -EKE---------------------------------------------------ERDRASGYRK 71

  Fly   155 ESPLTHHHHHHHHESKRQRIDHSSSSNSSFTH----------------NSFVPEPDSNSSSSE-- 201
            ..|          :.||..:....|.:...:|                .|..||....:.:.|  
Human    72 RGP----------KPKRLLLQRLYSMDLRSSHKAKGKEKLCFSLTCPLGSGSPEGVVKAGAPELV 126

  Fly   202 DQ-PLIGT-------KRKA-EVLKESGKIGVTIKTSPDGPTIKPQPTQQVTPSQQQPFQDQQQAE 257
            |: ||:.|       .||| :.|:.|.|     |..|.||.::....::....|:.|..|..|| 
Human   127 DKGPLVPTLPFPLRKPRKAHKYLRLSRK-----KFPPRGPNLESHSHRRELFLQEPPAPDVLQA- 185

  Fly   258 KIASEAATQLKSEQQATPLATEAINTTPAESGAEEEEVAN-EEGNQQAPQVPSENNNIPKPCNNL 321
                                  |....||....|||..|: .||                     
Human   186 ----------------------AGEWEPAAQPPEEEADADLAEG--------------------- 207

  Fly   322 AINQKQPLTPLSPRALPPRFWLPAKCNISNRVVITDVTVNLETVTIRECKTERGFFRERDMK 383
                ..|.||    |||           |:.|.:||:|.|..|||.||.:...||||:|..|
Human   208 ----PPPWTP----ALP-----------SSEVTVTDITANSITVTFREAQAAEGFFRDRSGK 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PcNP_524199.1 CHROMO 25..77 CDD:214605 31/51 (61%)
CBX7NP_783640.1 CD_Cbx7 7..62 CDD:349293 34/119 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 190..220 15/69 (22%)
CBX7_C 209..240 CDD:407338 17/45 (38%)
Required for cellular lifespan extension 223..236 7/12 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 71 1.000 Domainoid score I9425
eggNOG 1 0.900 - - E1_KOG2748
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 124 1.000 Inparanoid score I4722
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1628171at2759
OrthoFinder 1 1.000 - - FOG0000191
OrthoInspector 1 1.000 - - otm41418
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2447
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
87.950

Return to query results.
Submit another query.