DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pc and Cbx5

DIOPT Version :9

Sequence 1:NP_524199.1 Gene:Pc / 40358 FlyBaseID:FBgn0003042 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_001070257.1 Gene:Cbx5 / 12419 MGIID:109372 Length:191 Species:Mus musculus


Alignment Length:128 Identity:39/128 - (30%)
Similarity:69/128 - (53%) Gaps:22/128 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 GSKGKLGRDNATDDPVDLVYAAEKIIQKRVKKGVVEYRVKWKGWNQRYNTWEPEVNILDRRLIDI 71
            |.|.|...|:::.:..: .|..||::.:|:.||.|||.:||||:::.:||||||.|:....||..
Mouse     2 GKKTKRTADSSSSEDEE-EYVVEKVLDRRMVKGQVEYLLKWKGFSEEHNTWEPEKNLDCPELISE 65

  Fly    72 YEQTNKSSGTPSKRGIKKKEKEPD-PEPESEEDEYTFTENDVDTHQATTSSATHDKESKKEKK 133
            :.:..|          |.||.|.: |..:||.::          .:::.|::..|.:|||:::
Mouse    66 FMKKYK----------KMKEGENNKPREKSEGNK----------RKSSFSNSADDIKSKKKRE 108

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PcNP_524199.1 CHROMO 25..77 CDD:214605 22/51 (43%)
Cbx5NP_001070257.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..21 4/19 (21%)
CD_HP1alpha_Cbx5 19..68 CDD:349298 22/48 (46%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 70..117 13/59 (22%)
CSD_HP1alpha_Cbx5 116..173 CDD:349302
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1628171at2759
OrthoFinder 1 1.000 - - FOG0000191
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.