DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pc and Cbx2

DIOPT Version :9

Sequence 1:NP_524199.1 Gene:Pc / 40358 FlyBaseID:FBgn0003042 Length:390 Species:Drosophila melanogaster
Sequence 2:XP_006532166.1 Gene:Cbx2 / 12416 MGIID:88289 Length:594 Species:Mus musculus


Alignment Length:172 Identity:44/172 - (25%)
Similarity:64/172 - (37%) Gaps:53/172 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   227 TSPDGPTIKPQPTQQVTPSQQQPFQDQQQAEKIASEAATQLKSEQQATPLATEAINT--TPAESG 289
            :.|.|..:...||            |..:.||:..:|.        |.|..:...:|  :.|.||
Mouse   456 SGPTGANMTNAPT------------DNNKGEKLTCKAT--------ALPAPSVKRDTVKSVAASG 500

  Fly   290 AEEEEVANEEG--------------NQQAPQVPSENNNIPKPCNNL--AINQKQPLTPLSPRALP 338
            .:|...|..||              |..:...| ::.::|....||  ||...|.          
Mouse   501 GQEGHTAPGEGRKPPALSELSTGEENSSSDSDP-DSTSLPSAAQNLSVAIQTSQD---------- 554

  Fly   339 PRFWLPAKCNISNRVVITDVTVNLETVTIRECKTERGFFRER 380
               |.|.: ::...|.:||||.||.|||::|..|..|||..|
Mouse   555 ---WKPTR-SLIEHVFVTDVTANLITVTVKESPTSVGFFNLR 592

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PcNP_524199.1 CHROMO 25..77 CDD:214605
Cbx2XP_006532166.1 CBX7_C 553..585 CDD:375056 14/45 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 71 1.000 Domainoid score I9385
eggNOG 1 0.900 - - E1_KOG2748
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1628171at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm43469
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.870

Return to query results.
Submit another query.