DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pc and nptxrb

DIOPT Version :9

Sequence 1:NP_524199.1 Gene:Pc / 40358 FlyBaseID:FBgn0003042 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_001037779.1 Gene:nptxrb / 100005257 ZFINID:ZDB-GENE-050208-595 Length:527 Species:Danio rerio


Alignment Length:292 Identity:60/292 - (20%)
Similarity:83/292 - (28%) Gaps:111/292 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 VNILDRRLIDIYEQTNKSSGTPSKRGIKKKEKEPDPEPESEEDEYTFTENDVDTHQATT----SS 121
            |..|:|.::.:            |..|:|.|.|..|.      ....||:.|.|..:..    ..
Zfish   213 VEELERAILQL------------KDRIEKLEMEIGPA------AINHTEHTVSTLGSIVVGEPGR 259

  Fly   122 ATHDKESKKEKKHHHHHHHHHHIKSERNSGRRSESPLTHHHHHHHHESKRQRIDHSSSSNSSFTH 186
            ...|.|.:.|||       ...::.||.:.|:.    |..||.|..:......:..:....|.|.
Zfish   260 PVEDLEGELEKK-------IRLLEKERKNLRKE----TQSHHQHIDQGINTLQERIAELEQSLTD 313

  Fly   187 NSFVPEPDSNSSSSEDQPLIGTKRKAEVLKESGKIGVTIKTSPDGPTIKPQPTQQVTPSQQQPFQ 251
            .|: |:              |.|....| :.:...|:..:..|                      
Zfish   314 YSY-PQ--------------GYKLSFPV-RTNYMYGLVRRNIP---------------------- 340

  Fly   252 DQQQAEKIASEAATQLKSEQQATPLATEAINTTPAESGAEEEEVANEEGNQQAPQVPSENN---- 312
                 |..|..|...||                |||||.         |...:..||.:.|    
Zfish   341 -----EMYAFTACLWLK----------------PAESGI---------GTPFSYAVPEQPNQLVL 375

  Fly   313 --NIPKPCNNLAINQKQPLTPLSPRALPPRFW 342
              .|..|. .|.||.|....|||   ||...|
Zfish   376 LQGIHNPA-ELLINDKVAQLPLS---LPKGIW 403

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PcNP_524199.1 CHROMO 25..77 CDD:214605 3/15 (20%)
nptxrbNP_001037779.1 CCDC-167 210..>285 CDD:291844 21/96 (22%)
LamG 319..514 CDD:304605 31/142 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2748
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.