DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7632 and YNR064C

DIOPT Version :9

Sequence 1:NP_649302.1 Gene:CG7632 / 40357 FlyBaseID:FBgn0037071 Length:330 Species:Drosophila melanogaster
Sequence 2:NP_014462.1 Gene:YNR064C / 855801 SGDID:S000005347 Length:290 Species:Saccharomyces cerevisiae


Alignment Length:212 Identity:45/212 - (21%)
Similarity:77/212 - (36%) Gaps:30/212 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 WY---GPKHVRPIVGMHGWQDNAGTFDTLAPLLPSHLSFLSIDAPGHGLSSWLPPGTSYHSIDLV 111
            ||   |......|:.:||:..::..|..|.|||......::.|.||.|.:. .|....:....|.
Yeast    20 WYREAGAAGNPTILLLHGFPTSSNMFRNLIPLLAGQFHIIAPDLPGFGFTE-TPENYKFSFDSLC 83

  Fly   112 LITRRLMEEYNWDKISILAHSMSSINGFVFSALFPDKVDLFVGLDVLKPPVRSARGIVDSLTERI 176
            .....|::..:.:|.::......|..||..:..||.::...|        .::.....:.|.:|.
Yeast    84 ESIGYLLDTLSIEKFAMYIFDYGSPVGFRLALKFPSRITGIV--------TQNGNAYEEGLDDRF 140

  Fly   177 ESALKLERRLKSGSEPPAY---------DWDQLVTRLHEGSNKSVSIDACKY-----LLQRNCKP 227
            ...||  ...||....|.:         |...::.:.|:|.....|:|...|     |:||.  .
Yeast   141 WGPLK--EYWKSYQSDPVFVKSLIPYLEDPANVICQYHDGVPAIESVDPAAYTLDIALIQRT--G 201

  Fly   228 STHEPHKYYFSRDNRLK 244
            .|....:.:|...|.:|
Yeast   202 QTDIQLRLFFDYQNNIK 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7632NP_649302.1 MhpC 57..326 CDD:223669 42/202 (21%)
YNR064CNP_014462.1 Abhydrolase_1 30..275 CDD:395444 42/202 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157341721
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.