DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7632 and IMO32

DIOPT Version :9

Sequence 1:NP_649302.1 Gene:CG7632 / 40357 FlyBaseID:FBgn0037071 Length:330 Species:Drosophila melanogaster
Sequence 2:NP_011545.1 Gene:IMO32 / 852919 SGDID:S000003263 Length:342 Species:Saccharomyces cerevisiae


Alignment Length:289 Identity:69/289 - (23%)
Similarity:113/289 - (39%) Gaps:43/289 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 PIVGMHGWQDNAGTFDTLAPLLPSHLS---FLSIDAPGHGLSSWLPPGTSYHSIDLV------LI 113
            ||:.:||...|.....::...|...|.   :| :|...||.|    |.:|.|:.:::      .|
Yeast    76 PIIILHGLFGNKLNNRSIGRNLNKKLGRDVYL-LDLRNHGSS----PHSSVHNYEVMSEDVKHFI 135

  Fly   114 TRRLMEEYNWDKISILAHSMSSINGFVFSALFPDKVDLFVGLDVLKPPVRSARGIVD---SLTER 175
            |:..:.. |...| |:.|||......:.....|....:.|.::.....:|.....|:   :|.|.
Yeast   136 TKHELNT-NGGPI-IIGHSMGGKVAMMLVLKNPQLCSMLVCIENAPVSLRPNAEFVEYIKALMEI 198

  Fly   176 IESALKLERRLKSGSEPPA--YDWDQLVTRLHEGSNKSVSID----ACKYLLQRNCKPSTHEPHK 234
            :....|..|.||...|..|  ...::||.|....:.|.|.:|    ...|..:.....:|     
Yeast   199 VNDKGKTIRTLKQADEHLAERIGGNELVRRFLLTALKKVKMDNSSSVSSYTFEERIPLAT----- 258

  Fly   235 YYFSRDNRLKSSLFYTLHQEVPMEMAR-RIKCPHLFIKALQAPYYERKEYFDEVLAELQKNPLFE 298
                    ||.::........|::.|| |...|.|||:|.|: :|...||...:.|..   |.||
Yeast   259 --------LKDAIVKGEIAAWPLDPARERWTRPALFIRATQS-HYVVDEYLPIIGAFF---PRFE 311

  Fly   299 YHEVEGTHHVHLNEPEKVAPIINSFINRY 327
            ..:::..|.|:..:|.:.|..|..|:.|:
Yeast   312 TRDIDAGHWVNAEKPGECAESIVDFVERH 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7632NP_649302.1 MhpC 57..326 CDD:223669 68/286 (24%)
IMO32NP_011545.1 PRK10673 74..326 CDD:182637 64/273 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.