DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7632 and EAT1

DIOPT Version :9

Sequence 1:NP_649302.1 Gene:CG7632 / 40357 FlyBaseID:FBgn0037071 Length:330 Species:Drosophila melanogaster
Sequence 2:NP_011529.1 Gene:EAT1 / 852898 SGDID:S000003247 Length:328 Species:Saccharomyces cerevisiae


Alignment Length:323 Identity:64/323 - (19%)
Similarity:112/323 - (34%) Gaps:97/323 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 RP-IVGMHGWQDNAGTFDTLAPLLPSHL--SFLSIDAPGHGLSSWLPPGTSYHSIDLVLITRRL- 117
            || |:.:||...:...|.:|..||...|  ...|:|...||:|   |....|   |...:|..| 
Yeast    38 RPAIINIHGLLGSHVMFHSLNKLLSRKLDADIFSVDVRNHGIS---PKAIPY---DYTTLTNDLI 96

  Fly   118 --MEEY-------------NWDKISILAHSMSSINGFVFSALFPDKVDLFVGLDVLKPPVRSARG 167
              :|.:             ...||::|.....:||           :...:.:|:  ||..:.. 
Yeast    97 YFIETHIGLERPIYLLGFSMGGKIALLTTLYKNIN-----------IRKCISIDL--PPYETPE- 147

  Fly   168 IVDSLTERIESALKLERR---LKSGSEPPAYDWDQLVTRLHEGSNKSVSIDACKYLLQRNCKPST 229
            :...:.:..:..:::.||   :..||.    .|.:.|..|.    ||:..:      :|.|..:.
Yeast   148 LDPMILQNYDLIMRIIRRDVKILRGSP----SWQKKVLELF----KSLECN------KRKCGGAV 198

  Fly   230 HEPHKYYFSR-------DNRLKSSLFYTLHQEVP-----MEMARRIKCPHLFIKALQAP-YYERK 281
                ..||:.       :|..::.|.|...|..|     |.::   ..|:|..:..:.| ...::
Yeast   199 ----ALYFANGFLSVKSNNVHQAQLHYEQQQHDPYINYSMPLS---SMPNLLDEVKKWPDLSNQR 256

  Fly   282 EYFDEVLAE--------LQKN-------------PLFEYHEVEGTHHVHLNEPEKVAPIINSF 323
            ::|.:..|.        ||.|             |..:..|....|::.|..||.....|.:|
Yeast   257 DFFQKGTASRKVLFMKGLQSNFINNDYSLLRYNFPCADVREFNTGHNLLLENPEDSFKCILNF 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7632NP_649302.1 MhpC 57..326 CDD:223669 64/323 (20%)
EAT1NP_011529.1 Abhydrolase_1 39..309 CDD:395444 59/310 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.