DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7632 and LDH1

DIOPT Version :9

Sequence 1:NP_649302.1 Gene:CG7632 / 40357 FlyBaseID:FBgn0037071 Length:330 Species:Drosophila melanogaster
Sequence 2:NP_009763.2 Gene:LDH1 / 852503 SGDID:S000000408 Length:375 Species:Saccharomyces cerevisiae


Alignment Length:83 Identity:24/83 - (28%)
Similarity:34/83 - (40%) Gaps:18/83 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 AGTFDTLAPLL----PSHLSFLSIDAPGHGLSS-WLP-PGTSYHSIDLVLITRRL---------- 117
            ||..:...|||    ....:||::|.||.|.|| |.. |......:..||:...|          
Yeast    96 AGNLEQFEPLLELVDSDQKAFLTLDLPGFGHSSEWSDYPMLKVVELIFVLVCDVLRKWSTAVPNN 160

  Fly   118 --MEEYNWDKISILAHSM 133
              :..:|..||.::.|||
Yeast   161 DNVNPFNGHKIVLVGHSM 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7632NP_649302.1 MhpC 57..326 CDD:223669 24/83 (29%)
LDH1NP_009763.2 EstA 4..375 CDD:224001 24/83 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157341713
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.