DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7632 and AT1G78210

DIOPT Version :9

Sequence 1:NP_649302.1 Gene:CG7632 / 40357 FlyBaseID:FBgn0037071 Length:330 Species:Drosophila melanogaster
Sequence 2:NP_565173.1 Gene:AT1G78210 / 844157 AraportID:AT1G78210 Length:314 Species:Arabidopsis thaliana


Alignment Length:290 Identity:56/290 - (19%)
Similarity:101/290 - (34%) Gaps:72/290 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 MHG--------WQDNAGTFDTLAPLLPSHLSFLSIDAPGHGLSSWLPPGTSYHSIDLVLITRRLM 118
            :||        |.|.|........|....|.|..      |.|:..|..:.......::   |.:
plant    57 IHGLGATAIWQWYDVARRLSRYFNLYIPDLVFFG------GSSTTRPERSDIFQAQTLM---RAL 112

  Fly   119 EEYNWDKISILAHSMSSINGFVFSALFPDKVDLFV----GLDVLKPPVRSARGIVDSLTERI--- 176
            |..:..|.|::..|.....|:..::::.|.|:..|    .:.|.:..:::....|..|.|..   
plant   113 EAQSVKKFSLVGLSYGGFVGYRMASMYADAVEKVVICCAAVCVEEKDMKAGVFKVSDLDEASKIL 177

  Fly   177 --ESALKLERRLKSGSEPPAYDWDQLVTRLHEGSNKSVSIDACKYLLQRNCKPSTHEPHKYYFSR 239
              ||..||...:......||      :.||         :..|  ||        |:..::..:|
plant   178 VPESVKKLRELMGYIFYKPA------LARL---------VPTC--LL--------HDFIEHALTR 217

  Fly   240 DN-RLKSSLFYTLHQEVPMEMARRIKCPHLFIKALQAPYYERKEYFDEVLAELQKNPLFEYHE-- 301
            || ..|..|...:.::..:....::|.|.|.|      :.|..:.|     .|:.....|.|.  
plant   218 DNMEEKRELIKAIPKDRIISEIPKLKQPTLII------WGEHDQVF-----PLEMGKRLEKHVGD 271

  Fly   302 ------VEGTHHV-HLNEPEKVAPIINSFI 324
                  ::.|.|: :..:|:|...::.||:
plant   272 NGKLVIIKRTGHIFNFEKPKKFIKLLKSFL 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7632NP_649302.1 MhpC 57..326 CDD:223669 56/290 (19%)
AT1G78210NP_565173.1 MhpC 50..301 CDD:223669 55/288 (19%)
Abhydrolase_5 54..283 CDD:289465 51/270 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1454
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1285824at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.