DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7632 and AT1G77420

DIOPT Version :9

Sequence 1:NP_649302.1 Gene:CG7632 / 40357 FlyBaseID:FBgn0037071 Length:330 Species:Drosophila melanogaster
Sequence 2:NP_177867.1 Gene:AT1G77420 / 844079 AraportID:AT1G77420 Length:382 Species:Arabidopsis thaliana


Alignment Length:284 Identity:57/284 - (20%)
Similarity:83/284 - (29%) Gaps:106/284 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 PWGHISGKWYGPKHVRPIVGMHGWQDNAGT-------------------FDTLAPLLPSH-LSFL 86
            |.|..:.:||........:....|...:|.                   ||.:|..:... ....
plant    88 PSGIRTEEWYERNSKGEDIFCKSWLPKSGDEIKAAVCFCHGYGSTCTFFFDGIAKQIAGFGYGVY 152

  Fly    87 SIDAPGHGLSSWLPPGTSYH--SID---------------------------------LVLITRR 116
            :||.||.|||.    |...|  |.|                                 .|.:...
plant   153 AIDHPGFGLSD----GLHGHIPSFDDLADNAIEQFTKMKGRSELRNLPRFLLGQSMGGAVALKIH 213

  Fly   117 LMEEYNWDKISILAHSMSSING------------FVFSALFP-----DKVDL--FVGLDVLKPPV 162
            |.|...||.: ||...|..|:.            .:.|.|||     .|.||  |...|:.|..:
plant   214 LKEPQAWDGL-ILVAPMCKISEDVKPPPLVLKTLILMSTLFPKAKLFPKRDLSDFFFRDLSKRKL 277

  Fly   163 RSARGIVDSLTERIESALKL-------ERRLKSGSEPPAYDWDQLVTRLHEGSNKSVSIDACKYL 220
            .....|......|:::|::|       |.::...|.|        :..||..::|.......|:|
plant   278 CEYDVICYDDQTRLKTAVELLNATRDIEMQVDKVSLP--------LLILHGDTDKVTDPTVSKFL 334

  Fly   221 LQRNCKPSTHEPHKYYFSRDNRLK 244
                        ||:..|:|..||
plant   335 ------------HKHAVSQDKTLK 346

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7632NP_649302.1 MhpC 57..326 CDD:223669 53/269 (20%)
AT1G77420NP_177867.1 PLN02385 39..382 CDD:215216 57/284 (20%)
Hydrolase_4 117..361 CDD:288960 51/255 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.