DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7632 and AXR4

DIOPT Version :10

Sequence 1:NP_649302.1 Gene:CG7632 / 40357 FlyBaseID:FBgn0037071 Length:330 Species:Drosophila melanogaster
Sequence 2:NP_564672.2 Gene:AXR4 / 841941 AraportID:AT1G54990 Length:473 Species:Arabidopsis thaliana


Alignment Length:46 Identity:14/46 - (30%)
Similarity:23/46 - (50%) Gaps:1/46 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 GPKHVRPIVGMHGWQDNAGTFDTLAPLLPSH-LSFLSIDAPGHGLS 96
            |..|...:|.:||...::..|..:...|.|. :..::||.||:|.|
plant   113 GSIHTETVVIVHGLGLSSFAFKEMIQSLGSKGIHSVAIDLPGNGFS 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7632NP_649302.1 MenH 57..326 CDD:440361 12/41 (29%)
AXR4NP_564672.2 MenH 105..416 CDD:440361 14/46 (30%)

Return to query results.
Submit another query.