DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7632 and AT1G13820

DIOPT Version :9

Sequence 1:NP_649302.1 Gene:CG7632 / 40357 FlyBaseID:FBgn0037071 Length:330 Species:Drosophila melanogaster
Sequence 2:NP_172837.1 Gene:AT1G13820 / 837943 AraportID:AT1G13820 Length:339 Species:Arabidopsis thaliana


Alignment Length:272 Identity:54/272 - (19%)
Similarity:97/272 - (35%) Gaps:70/272 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 PIVGMHGWQDNAGTFDTLAPLL-PSHLSFLSIDAPGHGLSSW--LPP------------------ 101
            |:|.:||:..:...:....||| .:.|...:.|..|.|.|..  |||                  
plant    84 PVVLLHGFDSSCLEWRYTYPLLEEAGLETWAFDILGWGFSDLDKLPPCDVASKREHFYKFWKSHI 148

  Fly   102 -------GTSYH---SIDLVLITRRLMEEYNWDKISILAHSMSSINGFVFSALFPDKVDLFVGLD 156
                   |.|..   :||:.:.....:|.......|:.|....::      |..| |...:.|:.
plant   149 KRPVVLVGPSLGAAVAIDIAVNHPEAVESLVLMDASVYAEGTGNL------ATLP-KAAAYAGVY 206

  Fly   157 VLKP-PVRSARGIVDSLTERIESALKLERRLKSGSEPPAYDWDQLVTRLH------EGSNKSVSI 214
            :||. |:|.....:      ..:.:.||         .::||.: :.|||      |.:..|. :
plant   207 LLKSIPLRLYVNFI------CFNGISLE---------TSWDWTK-IGRLHCLYPWWEDATVSF-M 254

  Fly   215 DACKYLLQRNCKPSTHEPHKYYFSRDNRLKSSLFYTLHQEVPMEMARRI-KCPHLFIKALQAPYY 278
            .:..|.:....|..:.:....:...|..:.:.|.:.||.|:.....::| .|.||       |:.
plant   255 TSGGYNVTSLIKKVSQKTLILWGEDDQIISNKLAWRLHGELSNARVKQISNCGHL-------PHV 312

  Fly   279 ERKEYFDEVLAE 290
            |:.....:::||
plant   313 EKPAAVTKLIAE 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7632NP_649302.1 MhpC 57..326 CDD:223669 54/272 (20%)
AT1G13820NP_172837.1 MhpC 82..327 CDD:223669 54/272 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1454
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1285824at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.