DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7632 and AT5G21950

DIOPT Version :10

Sequence 1:NP_649302.1 Gene:CG7632 / 40357 FlyBaseID:FBgn0037071 Length:330 Species:Drosophila melanogaster
Sequence 2:NP_001331426.1 Gene:AT5G21950 / 832255 AraportID:AT5G21950 Length:360 Species:Arabidopsis thaliana


Alignment Length:145 Identity:30/145 - (20%)
Similarity:48/145 - (33%) Gaps:42/145 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 PNVRNSSSGPTKPFKILNKHFDEISIPVPWGHISGKWYGPKHVRPIVGMHGWQDNAGTFDTLAPL 78
            |...:||....||..:|...|..          |..|.....|:|:                   
plant    95 PPPSSSSENTQKPSLLLLHGFGP----------SAVWQWSHQVKPL------------------- 130

  Fly    79 LPSHLSFLSIDAP-----GHGLSSWLPPGTSYHSIDLVLITRRLMEEYNWDKISILAHSMSSING 138
              ||  |..:..|     |...||    |.:...:...|...:|||:...::.|::..|......
plant   131 --SH--FFRLYVPDLVFFGGSSSS----GENRSEMFQALCMGKLMEKLEVERFSVVGTSYGGFVA 187

  Fly   139 FVFSALFPDKVDLFV 153
            :..:.:||:||:..|
plant   188 YNMAKMFPEKVEKVV 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7632NP_649302.1 MenH 57..326 CDD:440361 20/102 (20%)
AT5G21950NP_001331426.1 MenH 104..353 CDD:440361 27/136 (20%)

Return to query results.
Submit another query.