DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7632 and AT4G39955

DIOPT Version :9

Sequence 1:NP_649302.1 Gene:CG7632 / 40357 FlyBaseID:FBgn0037071 Length:330 Species:Drosophila melanogaster
Sequence 2:NP_568075.1 Gene:AT4G39955 / 830156 AraportID:AT4G39955 Length:328 Species:Arabidopsis thaliana


Alignment Length:339 Identity:58/339 - (17%)
Similarity:106/339 - (31%) Gaps:137/339 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 VPWGHISGKWYGPKHVRP-IVGMHG------WQDNAGTFDTLAP----LLPSHLSFLSIDAPGHG 94
            :|..||        |.:| ::.:||      ||.:. ..|...|    .:|..:.|         
plant    41 IPLTHI--------HTKPTLLLLHGIGANAMWQWDR-FIDRFIPRFNVYVPDLIFF--------- 87

  Fly    95 LSSWLPPGTSY-------HSIDLVLITRRLMEEYNWDKISILAHSMSSINGFVFSALFPDKVDLF 152
                   |.||       .|.....: .:.|:.|....:::...|......:..:|.|.::||..
plant    88 -------GDSYTTRPDRSESFQATCV-MKAMDAYGVRTMTVAGLSYGGFVAYSLAAQFKERVDRV 144

  Fly   153 V---------------GLDVLKPPVRSARGIVDSLTERIESALKLERRLKSGSEPP-------AY 195
            |               |:..:|.|..:|..:.......:...|:|     |..:||       |.
plant   145 VLICAGVALEEKDSEDGMFKVKSPEEAAAVLFPQSPSMLRRLLQL-----SFYKPPIWIPSCFAM 204

  Fly   196 DW------------DQLVTRLHEGSNKSVSIDACKYLLQRNCKPSTHEPHKYYFSRDNRLKSSLF 248
            |:            .:||..||:| .:..::            |...:|....:..::       
plant   205 DYIHVMCKDYLQERKELVEALHKG-RRFANL------------PKITQPTLMIWGEED------- 249

  Fly   249 YTLHQEVPMEMARRIKCPHLFIKALQAPYYERKEYFDEVLAE---LQKNPLFEYHEVEGTHHVHL 310
                |..|:|:|.|:                 |.|..|..|:   |:|.          .|.::.
plant   250 ----QVFPVELAHRL-----------------KRYLGEDRAQLVLLKKT----------GHAINE 283

  Fly   311 NEPEKVAPIINSFI 324
            .:|:::...:.||:
plant   284 EKPKEMYKHMKSFL 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7632NP_649302.1 MhpC 57..326 CDD:223669 54/323 (17%)
AT4G39955NP_568075.1 MhpC 47..297 CDD:223669 54/323 (17%)
Abhydrolase_5 51..280 CDD:289465 49/302 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1454
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1285824at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.