DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7632 and AT4G36610

DIOPT Version :9

Sequence 1:NP_649302.1 Gene:CG7632 / 40357 FlyBaseID:FBgn0037071 Length:330 Species:Drosophila melanogaster
Sequence 2:NP_195379.1 Gene:AT4G36610 / 829813 AraportID:AT4G36610 Length:317 Species:Arabidopsis thaliana


Alignment Length:330 Identity:69/330 - (20%)
Similarity:103/330 - (31%) Gaps:114/330 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 RNSSSG-PTKPFKILNKHFDEISIPVPWGHISGKWYGPKHVRPIVGM-HG--------WQDNAGT 71
            :||.:| ||||.|                        ||  :|:|.: ||        ||...|.
plant    45 KNSGTGKPTKPDK------------------------PK--KPVVLLIHGFAGEGIVTWQFQVGA 83

  Fly    72 FD-TLAPLLPSHLSFLSIDAPGHGLSSWLPPGTSY---------HSIDLVLITRRLMEEYNWDKI 126
            .. ..:..:|..|.|                |.||         ...|.::...|::   ..||.
plant    84 LSKKYSVYIPDLLFF----------------GGSYTDNSDRSPAFQADCLVKGLRIL---GVDKF 129

  Fly   127 SILAHSMSSINGFVFSALFPDKVDLFVGLDVLKPPVRSARGIVDSLTERIESALKLERRLKSGSE 191
            ..:..|...:..|..:..:||.|...|           ..|.:.::|:.|..| .|.|...|.|.
plant   130 VPVGFSYGGMVAFKIAEAYPDMVRAIV-----------VSGSIPTMTDTINEA-SLNRLGFSSST 182

  Fly   192 PPAYDWDQLVTRLHEGSNKSVSIDACKYLLQRNCKPSTHEPHKYYFSRDNRLKSSLFYTLHQEVP 256
                  |.|:         ..|:...|.|.    ..:.|:|  .:|.:  ||.......:... .
plant   183 ------DLLL---------PTSVTGLKALF----TIAVHKP--LWFPK--RLFKDYIEVMFNN-R 223

  Fly   257 MEMARRIKCPHLFIKALQAPYYERK---------EYFDEVLAELQKNPLFEYHEVEGT----HHV 308
            .|.|..::...:..|..|.|::.||         :.||..||...|..:.|...:|..    |.|
plant   224 KERAELLEAVVVSNKEAQIPHFPRKIHFLWGESDQIFDLELARDMKEQIGENATIESIKKAGHLV 288

  Fly   309 HLNEP 313
            .|..|
plant   289 QLERP 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7632NP_649302.1 MhpC 57..326 CDD:223669 59/289 (20%)
AT4G36610NP_195379.1 MhpC 62..307 CDD:223669 58/287 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1454
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1285824at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.