DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7632 and AT4G15955

DIOPT Version :9

Sequence 1:NP_649302.1 Gene:CG7632 / 40357 FlyBaseID:FBgn0037071 Length:330 Species:Drosophila melanogaster
Sequence 2:NP_001154238.1 Gene:AT4G15955 / 827278 AraportID:AT4G15955 Length:304 Species:Arabidopsis thaliana


Alignment Length:350 Identity:70/350 - (20%)
Similarity:126/350 - (36%) Gaps:99/350 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LFLLKQLPNVRNSSSGPTKPFKILNKH-FDEISIPVPWGHISGKWYGPKHVRPIVGMHGWQ---- 66
            :.:.::.|:|  :.:|..:|..||..| |.|:            ||..:|....:...|::    
plant    17 MHVAEKSPSV--AGNGAIRPPVILFLHGFPEL------------WYTWRHQMVALSSLGYRTIAP 67

  Fly    67 DNAGTFDTLAPLLPSHLSFLSIDAPGHGLSSWLPPGTSYHSI-DLVLITRRLMEEYNWDKISILA 130
            |..|..||.||        .|:||           .||.|.: ||:.:...::.:.  :|:.::.
plant    68 DLRGYGDTDAP--------ESVDA-----------YTSLHVVGDLIGLIDAVVGDR--EKVFVVG 111

  Fly   131 HSMSSINGFVFSALFPDKVDLFVGLDVLKPPVRSARGIVDSLTERIESALKLERRLKSGSEPPAY 195
            |...:|..:......||:|...|.:.|:..|....|                    |..|...|:
plant   112 HDWGAIIAWHLCLFRPDRVKALVNMSVVFDPWNPKR--------------------KPTSTFKAF 156

  Fly   196 DWD----------QLVTRLH-----EGSNKSVSIDA------CKYLLQRNCKPSTHEPHKYYFSR 239
            ..|          :::.::|     :..:.|||:.:      .||.:.:..|.....|..||.:.
plant   157 YGDDYYICRFQLLEILIKIHVCIVGKRYDDSVSLPSWLTDSDVKYYVSKYEKNGFTGPVNYYRNM 221

  Fly   240 DN--RLKSSLFYTLHQEVPMEMARRIKCPHLFIKALQAPYYE---RKEYFDEVLAELQKNPLFEY 299
            |.  .|..||           ...::|.|..||...|...|.   .|:|..:...:.....|.|.
plant   222 DRTWELMGSL-----------SNAKVKVPVKFIIGDQDLTYHIPGSKKYIHDGRFKSHVPLLDEV 275

  Fly   300 HEVEGT-HHVHLNEPEKVAPIINSF 323
            ..::|. |.:|...|::::..|:.:
plant   276 VVIKGVGHFIHEERPDEISKHIHDY 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7632NP_649302.1 MhpC 57..326 CDD:223669 58/298 (19%)
AT4G15955NP_001154238.1 MhpC 7..301 CDD:223669 70/349 (20%)
Abhydrolase 35..>134 CDD:304388 29/131 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 52 1.000 Inparanoid score I2617
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.