DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7632 and AT3G10840

DIOPT Version :9

Sequence 1:NP_649302.1 Gene:CG7632 / 40357 FlyBaseID:FBgn0037071 Length:330 Species:Drosophila melanogaster
Sequence 2:NP_187695.3 Gene:AT3G10840 / 820253 AraportID:AT3G10840 Length:466 Species:Arabidopsis thaliana


Alignment Length:378 Identity:73/378 - (19%)
Similarity:121/378 - (32%) Gaps:146/378 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 KILNKH--FDEISIPVPWGHISGKWYGPKHVRPIVGMHGWQDNAGTFD------TLAPLLPSHLS 84
            |:|:.|  .|::|...|....:     ||...|::.:||:  .|..|.      .||.|:.|.: 
plant   105 KVLDPHTLSDDVSNTSPHAQET-----PKTKFPMILLHGF--GASVFSWNRVMKPLARLVSSKV- 161

  Fly    85 FLSIDAPGHGLSSWL-----------PPGTSYHSIDLVLITRRLMEEYNWDKISILAHSMS---S 135
             |:.|.|..||:|.:           .|...|..:..||.|...::....||..::.||..   :
plant   162 -LAFDRPAFGLTSRIFHPFSGATNDAKPLNPYSMVYSVLTTLYFIDVLAADKAILVGHSAGCPVA 225

  Fly   136 INGF------------VFSALFP-------------DK---VDLFVG--LDVLKPPVRSARGIVD 170
            ::.:            |..|:|.             ||   ...|:|  :::.|..:|:...:|.
plant   226 LDAYFEAPERVAALILVAPAIFAPRPVATTDAGENRDKEAPTSNFLGTLVELTKGVIRAVLRVVT 290

  Fly   171 SLTERIESALK--LERRLKS-----------------------------------GSEPP--AYD 196
            .:...:.|..|  |...|:|                                   |...|  |..
plant   291 GMANMLSSLYKKALAAFLRSFLGVMLVRMAINKFGVTAVRNAWYDSKQVTDHVVQGYTKPLKAKG 355

  Fly   197 WDQLVTRL-------HEGSNKSVSIDACKYLLQRNCKPSTHEPHKYYFSRDNRLKSSLFYTLHQE 254
            ||:.:...       :.||.|.:.:.  |.|.:..|      |........:|:           
plant   356 WDKALVEFTVATLTDNNGSEKKLPLS--KRLQEIKC------PVLIVTGDTDRI----------- 401

  Fly   255 VPMEMARRI-------------KCPHLFIKALQAPYYERKEYFDEVLAELQKN 294
            ||...|.|:             ||.||       |..|:.:.|..::|:...|
plant   402 VPAWNAERLARAIPGSVFEVIKKCGHL-------PQEEKPDEFISIVAKFLGN 447

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7632NP_649302.1 MhpC 57..326 CDD:223669 65/347 (19%)
AT3G10840NP_187695.3 MhpC 111..445 CDD:223669 69/368 (19%)
Abhydrolase_5 132..292 CDD:289465 34/163 (21%)
Abhydrolase_5 <379..427 CDD:289465 11/66 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1454
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1285824at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.