DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7632 and AT2G26750

DIOPT Version :9

Sequence 1:NP_649302.1 Gene:CG7632 / 40357 FlyBaseID:FBgn0037071 Length:330 Species:Drosophila melanogaster
Sequence 2:NP_180243.1 Gene:AT2G26750 / 817216 AraportID:AT2G26750 Length:320 Species:Arabidopsis thaliana


Alignment Length:376 Identity:85/376 - (22%)
Similarity:133/376 - (35%) Gaps:123/376 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 NVRNSS-------SGPTKPFKILNKH-FDEISIPVPWGHISGKWYGPKHVRPIVGMHGWQDNAGT 71
            |||.:.       .||:....:|..| |.|:            ||..:|....:...|::     
plant     5 NVRGNGIDIHVAIQGPSDGTIVLLLHGFPEL------------WYSWRHQISGLAARGYR----- 52

  Fly    72 FDTLAPLLPSHLSFLSIDAPGHGLSSWLPPGTSYHSI-DLVLITRRLMEEYNWDKISILAHSMSS 135
                 .:.|....:...|||.. :||:    |.::.: |||.:...|::|..  |:.::.|...:
plant    53 -----AVAPDLRGYGDSDAPAE-ISSF----TCFNIVGDLVAVISTLIKEDK--KVFVVGHDWGA 105

  Fly   136 INGFVFSALFPDKVDLFVGLDV----------LKP--PVRSARG-----------------IVDS 171
            :..:......||||...|.|.|          :||  .:|:..|                 |.:.
plant   106 LIAWYLCLFRPDKVKALVNLSVPLSFWPTDPSVKPVDRMRAVYGNDYYVCRFQEVGDIEAEIAEV 170

  Fly   172 LTERIESALKLER--------RLKS-----GSEPPAYDWDQLVTRLHEGSNKSVSIDACKYLLQR 223
            .|||:...|...|        :.||     |...|...|      |.|   :.|:....|:..:.
plant   171 GTERVMKRLLTYRTPGPLIIPKDKSFWGSKGETIPLPSW------LTE---EDVAYFVSKFKEKG 226

  Fly   224 NCKPSTHEPHKYY--FSRDNRLKSSLFYTLHQEVPMEMARRIKCPHLF-IKALQAPYYER--KEY 283
            .|.|.     .||  |:|:|.|....           :..:|:.|..| |..|...||..  |||
plant   227 FCGPV-----NYYRNFNRNNELLGPW-----------VGSKIQVPTKFVIGELDLVYYMPGVKEY 275

  Fly   284 -----FDEVLAELQKNPLFEYHEV-EG-THHVHLNEPEKVAPIINSFINRY 327
                 |.|.:      ||.|...| || .|.::..:|:::..||..||:.:
plant   276 IHGPQFKEDV------PLIEEPVVMEGVAHFLNQEKPQEILQIILDFISTF 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7632NP_649302.1 MhpC 57..326 CDD:223669 73/323 (23%)
AT2G26750NP_180243.1 MhpC 2..317 CDD:223669 83/371 (22%)
Abhydrolase 8..>123 CDD:304388 28/143 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 52 1.000 Inparanoid score I2617
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.