DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7632 and SEH

DIOPT Version :9

Sequence 1:NP_649302.1 Gene:CG7632 / 40357 FlyBaseID:FBgn0037071 Length:330 Species:Drosophila melanogaster
Sequence 2:NP_180242.1 Gene:SEH / 817215 AraportID:AT2G26740 Length:321 Species:Arabidopsis thaliana


Alignment Length:362 Identity:76/362 - (20%)
Similarity:126/362 - (34%) Gaps:115/362 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 GPTK-PFKILNKHFDEISIPVPWGHISGKWYGPKHVRPIVGMHGWQDNAGTFDTLAPLLPSHLSF 85
            ||:. |..:|...|.|:            ||..:|..|.:...|::          .:.|....:
plant    19 GPSDGPIVLLLHGFPEL------------WYSWRHQIPGLAARGYR----------AVAPDLRGY 61

  Fly    86 LSIDAPGHGLSSWLPPGTSYHSI-DLVLITRRLMEEYNWDKISILAHSMSSINGFVFSALFPDKV 149
            ...|||.. :||:    |.::.: ||:.:...|....: :|:.::.|...::..:......||:|
plant    62 GDSDAPAE-ISSY----TCFNIVGDLIAVISALTASED-EKVFVVGHDWGALIAWYLCLFRPDRV 120

  Fly   150 DLFVGLDV---LKP------PVRSARG--------------------IVDSLTERIESALKLER- 184
            ...|.|.|   .:|      ||...|.                    |.:..|||:...|...| 
plant   121 KALVNLSVPFSFRPTDPSVKPVDRMRAFYGDDYYICRFQEFGDVEAEIAEVGTERVMKRLLTYRT 185

  Fly   185 -------RLKS-----GSEPPAYDWDQLVTRLHEGSNKSVSIDACKYLLQRNCKPSTHEPHKYY- 236
                   :.||     |...|...|              ::.:...|.:.:..:.....|..|| 
plant   186 PGPVIIPKDKSFWGSKGETIPLPSW--------------LTEEDVAYFVSKFEEKGFSGPVNYYR 236

  Fly   237 -FSRDNRLKSSLFYTLHQEVPMEMARRIKCPHLF-IKALQAPYYER--KEY-----FDEVLAELQ 292
             |:|:|.|....           :..:|:.|..| |..|...||..  |||     |.|.:    
plant   237 NFNRNNELLGPW-----------VGSKIQVPTKFVIGELDLVYYMPGVKEYIHGPQFKEDV---- 286

  Fly   293 KNPLFEYHEV-EG-THHVHLNEPEKVAPIINSFINRY 327
              ||.|...| || .|.::..:|:::..||..||:::
plant   287 --PLLEEPVVMEGVAHFINQEKPQEILQIILDFISKF 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7632NP_649302.1 MhpC 57..326 CDD:223669 67/323 (21%)
SEHNP_180242.1 MhpC 2..318 CDD:223669 74/357 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 52 1.000 Inparanoid score I2617
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.