DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7632 and EPHX3

DIOPT Version :9

Sequence 1:NP_649302.1 Gene:CG7632 / 40357 FlyBaseID:FBgn0037071 Length:330 Species:Drosophila melanogaster
Sequence 2:NP_001136358.1 Gene:EPHX3 / 79852 HGNCID:23760 Length:360 Species:Homo sapiens


Alignment Length:297 Identity:60/297 - (20%)
Similarity:114/297 - (38%) Gaps:52/297 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 SGKWYGPKHVRPIVGMHGWQDNAGTFDTLAPLLPSHLSFLSIDAPGHGLSSWLPPGTSYHSIDLV 111
            :|:..||.    ::.:||:.:|..::........|....:::|..|:|.|. .|.....::|||:
Human    92 AGRGNGPL----MLFLHGFPENWFSWRYQLREFQSRFHVVAVDLRGYGPSD-APRDVDCYTIDLL 151

  Fly   112 LI-TRRLMEEYNWDKISILAHSMSSINGFVFSALFPDKVDLFVGLDVLKPPVRSARGIVDSLTER 175
            |: .:.::....:.|..::||...::..:.||..:|..|:..|.:......|..     |.....
Human   152 LVDIKDVILGLGYSKCILVAHDWGALLAWHFSIYYPSLVERMVVVSGAPMSVYQ-----DYSLHH 211

  Fly   176 IESALK-----------LERRLKSGSEPPAYDWDQLVTRLHEGSNKSVSIDACKYLLQRNCKPST 229
            |....:           |..:|.|.|     |:..|.|.|   :::...|..        ..||.
Human   212 ISQFFRSHYMFLFQLPWLPEKLLSMS-----DFQILKTTL---THRKTGIPC--------LTPSE 260

  Fly   230 HEPHKYYFSRDNRLKSSLFY--TLHQEVPMEMARRIKCPHLFIKALQAPYYERKEYFDEVLAELQ 292
            .|...|.||:...|...|.|  .|.:..|:| .:.:..|.|.:      :.|:..|.:..|.|..
Human   261 LEAFLYNFSQPGGLTGPLNYYRNLFRNFPLE-PQELTTPTLLL------WGEKDTYLELGLVEAI 318

  Fly   293 KNPL----FEYHEVEGT-HHVHLNEPEKVAPIINSFI 324
            .:..    .|.|.:.|. |.:..:.|:::...:.:|:
Human   319 GSRFVPGRLEAHILPGIGHWIPQSNPQEMHQYMWAFL 355

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7632NP_649302.1 MhpC 57..326 CDD:223669 57/287 (20%)
EPHX3NP_001136358.1 MhpC 80..351 CDD:223669 59/291 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165142108
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.