DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7632 and ABHD8

DIOPT Version :9

Sequence 1:NP_649302.1 Gene:CG7632 / 40357 FlyBaseID:FBgn0037071 Length:330 Species:Drosophila melanogaster
Sequence 2:NP_078803.4 Gene:ABHD8 / 79575 HGNCID:23759 Length:439 Species:Homo sapiens


Alignment Length:286 Identity:58/286 - (20%)
Similarity:99/286 - (34%) Gaps:73/286 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 MHG-------WQDNAGTF-----DTLAPLLPSHLSFLSIDAPGHGLSSWLPPGTSYHSIDLVLIT 114
            :||       |::....|     :.:||           |..|||.||......:|....|....
Human   181 IHGVGGSLAIWKEQLDFFVRLGYEVVAP-----------DLAGHGASSAPQVAAAYTFYALAEDM 234

  Fly   115 RRLMEEYNWDKISILAHSMSSINGFVFSAL----FPDKVDLFV-----GLDVLKPPVRSARGIVD 170
            |.:.:.|...:..::.||.    |..|...    :||.|...:     |...|:|...|...:..
Human   235 RAIFKRYAKKRNVLIGHSY----GVSFCTFLAHEYPDLVHKVIMINGGGPTALEPSFCSIFNMPT 295

  Fly   171 SLTERIESALKLERRLKSGSEPPAYDWDQLVTRLHEGSNKSVSIDACKYLLQRNCKPSTHEPHKY 235
            .:...:...|... .||:|.........||   |.||:..:||....:.::.....|...|.:  
Human   296 CVLHCLSPCLAWS-FLKAGFARQGAKEKQL---LKEGNAFNVSSFVLRAMMSGQYWPEGDEVY-- 354

  Fly   236 YFSRDNRLKSSLFYTLHQEVPMEMARRIKCPHLFIKALQAPYYERKEYFDEVLAELQKNPLFEYH 300
                            |.|:.:        |.|.:..:...:...:|  |:.:||:.   |..:.
Human   355 ----------------HAELTV--------PVLLVHGMHDKFVPVEE--DQRMAEIL---LLAFL 390

  Fly   301 EV--EGTHHVHLNEPEKVAPIINSFI 324
            ::  ||:|.|.|..||.|..:::.|:
Human   391 KLIDEGSHMVMLECPETVNTLLHEFL 416

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7632NP_649302.1 MhpC 57..326 CDD:223669 58/286 (20%)
ABHD8NP_078803.4 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 49..70
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 124..156
MhpC 156..416 CDD:223669 57/284 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165142114
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.