DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7632 and Ephx3

DIOPT Version :9

Sequence 1:NP_649302.1 Gene:CG7632 / 40357 FlyBaseID:FBgn0037071 Length:330 Species:Drosophila melanogaster
Sequence 2:NP_001028335.1 Gene:Ephx3 / 71932 MGIID:1919182 Length:424 Species:Mus musculus


Alignment Length:339 Identity:67/339 - (19%)
Similarity:124/339 - (36%) Gaps:75/339 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LFLLKQLPNVRNSSSGPTKPFKILNKHFDEISIPVPWGHISGKWYGPKHVRPI-VGMHGWQDNAG 70
            |.|...:|.|::|.         |..|:      |..||.:|         |: :.:||:.:|..
Mouse   135 LTLRVSVPPVKSSG---------LRLHY------VSAGHGNG---------PLMLFLHGFPENWF 175

  Fly    71 TFDTLAPLLPSHLSFLSIDAPGHGLSSWLPPGTSYHSIDLVL--ITRRLMEEYNWDKISILAHSM 133
            ::........||...:::|..|:..|. .|.....::|||:|  |...:: ...:.|..:::|..
Mouse   176 SWRYQLREFQSHFHVVAVDMRGYSPSD-APKEVDCYTIDLLLDDIKDTIL-GLGYSKCILVSHDW 238

  Fly   134 SSINGFVFSALFPDKVDLFVGLDVLKPPVRSARGIVDSLTERIESALK-----------LERRLK 187
            .:...:.||..:|..|:..|   |...|..|.  |.:.....|....:           |..:|.
Mouse   239 GASLAWEFSIYYPSLVERMV---VANGPPMSV--IQEYSIHHIGQIFRSNYMFLFQLPWLPEKLL 298

  Fly   188 SGSEPPAYDWDQLVTRLHEGSNKSVSIDACKYLLQRNCKPSTHEPHKYYFSRDNRLKSSLFY--T 250
            |.|     |:..|........|....:           .||..|...|:||:...|...:.|  .
Mouse   299 SMS-----DFQILKDTFTHRKNGIPGL-----------TPSELEAFLYHFSQPGCLTGPINYYRN 347

  Fly   251 LHQEVPMEMARRIKCPHLFIKALQAPYYERKEYFDEVLAELQKNPL----FEYHEVEGT-HHVHL 310
            :.:..|:| .:::..|.|.:      :.|:...|.:.|.|......    .|.|.:.|: |.:..
Mouse   348 VFRNFPLE-PKKLSTPTLLL------WGEKDFAFQQGLVEAIGRHFVPGRLESHILPGSGHWIPQ 405

  Fly   311 NEPEKVAPIINSFI 324
            :.|:::...:.:|:
Mouse   406 SHPQEMHQYMWAFL 419

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7632NP_649302.1 MhpC 57..326 CDD:223669 56/289 (19%)
Ephx3NP_001028335.1 Abhydrolase 139..>262 CDD:304388 32/151 (21%)
MhpC 144..415 CDD:223669 63/324 (19%)
Abhydrolase <341..424 CDD:304388 15/86 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167832171
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.