DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7632 and ABHD4

DIOPT Version :9

Sequence 1:NP_649302.1 Gene:CG7632 / 40357 FlyBaseID:FBgn0037071 Length:330 Species:Drosophila melanogaster
Sequence 2:NP_071343.2 Gene:ABHD4 / 63874 HGNCID:20154 Length:342 Species:Homo sapiens


Alignment Length:319 Identity:56/319 - (17%)
Similarity:105/319 - (32%) Gaps:106/319 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 PIVGMHGWQDNAGTFDTLAPLLPSHLSFLSIDAPGHGLSSWL-----PPGTSYHSIDLVLITRRL 117
            |:|.:||:....|.:......|.:..:..:.|..|.|.||..     |.|.....:..:...|..
Human    70 PLVMVHGFGGGVGLWILNMDSLSARRTLHTFDLLGFGRSSRPAFPRDPEGAEDEFVTSIETWRET 134

  Fly   118 MEEYNWDKISILAHSMSSINGFVFSALFPDKVDLFVGLDVLKPPVRSARGIVDSLTERIESALKL 182
            |   ....:.:|.||:.......:|..:||:|...:.:|....|:|...          .|.:: 
Human   135 M---GIPSMILLGHSLGGFLATSYSIKYPDRVKHLILVDPWGFPLRPTN----------PSEIR- 185

  Fly   183 ERRLKSGSEPPAYDWDQLVTRLHEGSNKSVSIDAC----KYLLQRNCKP------------STHE 231
                    .|||  |.:.|..:...||....:...    ..|:|| .:|            .|..
Human   186 --------APPA--WVKAVASVLGRSNPLAVLRVAGPWGPGLVQR-FRPDFKRKFADFFEDDTIS 239

  Fly   232 PHKYYFSRDNRLKSSLF------------------YTLHQEVPMEM------------ARRIKCP 266
            .:.|:.:..|....:.|                  :.:.::||:.|            .:::|  
Human   240 EYIYHCNAQNPSGETAFKAMMESFGWARRPMLERIHLIRKDVPITMIYGSDTWIDTSTGKKVK-- 302

  Fly   267 HLFIKALQAPYYERKEYFDEVLAELQKNPLFEYHEVEG-THHVHLNEPEKVAPIINSFI 324
                  :|.|        |..:.::         |::| :|||:.::|.    |.|:.:
Human   303 ------MQRP--------DSYVRDM---------EIKGASHHVYADQPH----IFNAVV 334

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7632NP_649302.1 MhpC 57..326 CDD:223669 56/319 (18%)
ABHD4NP_071343.2 PLN02894 8..338 CDD:215484 56/319 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.