DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7632 and ABHD6

DIOPT Version :9

Sequence 1:NP_649302.1 Gene:CG7632 / 40357 FlyBaseID:FBgn0037071 Length:330 Species:Drosophila melanogaster
Sequence 2:XP_005265391.1 Gene:ABHD6 / 57406 HGNCID:21398 Length:338 Species:Homo sapiens


Alignment Length:301 Identity:65/301 - (21%)
Similarity:111/301 - (36%) Gaps:72/301 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 PKHVRPIVGMHGWQDNAGTFDTLAPLLPSHLSFLSIDAPGHGLSSWLPPGTSYHSIDLVLI---T 114
            |.|...|:.:||:..:...:.::...||.:|..:.:|.|||       .||:..|:|.:.|   .
Human    68 PGHKPSILMLHGFSAHKDMWLSVVKFLPKNLHLVCVDMPGH-------EGTTRSSLDDLSIDGQV 125

  Fly   115 RRLME-----EYNWDKISILAHSMSSINGFVFSALFPDKVDLFVGLDVLKPPVRSARGIVDSLTE 174
            :|:.:     :.|.....::..||......|::|.:|..|              |:..:|.....
Human   126 KRIHQFVECLKLNKKPFHLVGTSMGGQVAGVYAAYYPSDV--------------SSLCLVCPAGL 176

  Fly   175 RIESALKLERRLKSGSEPPAYDWDQLVTRLHEGSNKSVSIDACKY--------LLQRNCKPSTHE 231
            :..:..:..:|||......|.:...|:....|  ..|..:..|.|        :||.  ......
Human   177 QYSTDNQFVQRLKELQGSAAVEKIPLIPSTPE--EMSEMLQLCSYVRFKVPQQILQG--LVDVRI 237

  Fly   232 PHKYYFSRDNRLKSSLF---------YTLHQEVPMEMARRIKCPHLFIKALQAPYYERKEYFD-- 285
            ||..::.:       ||         |:|||.:.     :||.|...|...|     .::..|  
Human   238 PHNNFYRK-------LFLEIVSEKSRYSLHQNMD-----KIKVPTQIIWGKQ-----DQQVLDVS 285

  Fly   286 --EVLAELQKNPLFEYHEVEGTHHVHLNEPEKVAPIINSFI 324
              ::||:...|...|..|..| |.|.:..|.|.|.:|..|:
Human   286 GADMLAKSIANCQVELLENCG-HSVVMERPRKTAKLIIDFL 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7632NP_649302.1 MhpC 57..326 CDD:223669 63/297 (21%)
ABHD6XP_005265391.1 MhpC 51..328 CDD:223669 65/301 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1454
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1285824at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.