DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7632 and LOC570571

DIOPT Version :9

Sequence 1:NP_649302.1 Gene:CG7632 / 40357 FlyBaseID:FBgn0037071 Length:330 Species:Drosophila melanogaster
Sequence 2:XP_021330474.1 Gene:LOC570571 / 570571 -ID:- Length:355 Species:Danio rerio


Alignment Length:322 Identity:66/322 - (20%)
Similarity:108/322 - (33%) Gaps:109/322 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 HVRPI-VGMHGWQDN-------------AGTFDTLAPLLPSHLSFLSIDAPGHGLSSWLPPGTSY 105
            |.:|: :.:||:.:|             :|.|.|:|           :|..|.|.|. .|.....
Zfish    95 HKKPLMLFLHGFPENCCRYSWRHQLLEFSGDFHTVA-----------LDLRGCGASD-APVRLED 147

  Fly   106 HSIDLVLI-TRRLMEEYNWDKISILAHSMSSINGFVFSALFPDKVDLFVGLDVLKP--------- 160
            :.::.:|. .|..:::.......::.|....:..:.|:...||.|.|.:.::...|         
Zfish   148 YLLEALLYDIRDTVDQLGHTSCILVGHDWGGMLAWHFALERPDMVQLLIVMNAPHPASWLGKKLF 212

  Fly   161 -PVRSARGIVDSLTERIESALKLERRLKSGSEPPAYDWDQLVTRLHEGSNKSVSIDACKYLLQRN 224
             ||     |:..|...|  .|.|.|.|..|                    |:|.|..    ..|.
Zfish   213 RPV-----IISLLFFNI--VLHLVRSLFCG--------------------KNVGIRN----RSRR 246

  Fly   225 CKPSTHEPHKYYFSRDNRLKSSLFY-------TL--HQEVPMEMARRIKCPHLFIKALQAPYYER 280
            ...|..|.:.|..|:...|.:.|.|       ||  ||:|      .:.|..::.:|        
Zfish   247 LTESQLEGYLYPLSQPGGLTAPLNYFRSLLSNTLYKHQDV------AVPCMLIWGEA-------- 297

  Fly   281 KEYFDEVLAE--------LQKNPLFEYHEVEGTHHVHLNEPEKVAPIINSF------INRYR 328
                |.:|.|        ..:.|:..:...|.:|.|..::||.|..:|..|      |..||
Zfish   298 ----DNILVEGMSGGTRPYVRGPVTIHTIPECSHWVQQDQPEIVNKLIWDFVLDKDVIKHYR 355

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7632NP_649302.1 MhpC 57..326 CDD:223669 63/316 (20%)
LOC570571XP_021330474.1 MhpC 82..341 CDD:223669 61/306 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170575098
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.