DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7632 and abhd6b

DIOPT Version :9

Sequence 1:NP_649302.1 Gene:CG7632 / 40357 FlyBaseID:FBgn0037071 Length:330 Species:Drosophila melanogaster
Sequence 2:NP_001315288.1 Gene:abhd6b / 558995 ZFINID:ZDB-GENE-070410-104 Length:344 Species:Danio rerio


Alignment Length:319 Identity:65/319 - (20%)
Similarity:110/319 - (34%) Gaps:106/319 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 GPKHVRP-IVGMHGWQDNAGTFDTLAPLLPSHLSFLSIDAPGHGLSSWLPPGTSYHSID------ 109
            |...:|| |:.:|.:..:..|:..:...||.||..|.:|.|||       .||:..:.|      
Zfish    71 GKPGLRPSILMLHDFSAHKDTWLPMLKYLPKHLHLLCVDMPGH-------EGTTRTNTDDYSIQG 128

  Fly   110 LVLITRRLME--EYNWDKISILAHSMSSINGFVFSALFPDKVDLFVGLDVLKPPVRSARGIVDSL 172
            .|...|:.:|  ..|.....::..||......|::|..|.  || .||.::.|            
Zfish   129 QVKRIRQFVETIRLNRKPFHLVGTSMGGTVAGVYAACHPS--DL-CGLTLICP------------ 178

  Fly   173 TERIESALKLERRLKSGSEPPAYDWDQLVTRLHEGSNKSVSIDACKYLLQRNCKPSTHEPHKYYF 237
                 :.||.:...|..|:            :|:       ::...|.|.....|||.|..:...
Zfish   179 -----AGLKNQNESKFDSQ------------MHD-------VEHSHYTLDIPLIPSTPEEMEEML 219

  Fly   238 SRDNRLKSSLFYTLHQEVPMEMARRIKCPHLFIKALQAPYYERKEYFDEVLAELQKNPLFEY--- 299
                :|.|.:.:.:.|:: ::....::.||       ..:|.  |.|.|:::|..|..|.|:   
Zfish   220 ----KLCSHVRFRVPQQI-LQGLVDVRIPH-------NDFYH--EVFMEIMSENSKYALHEHLQE 270

  Fly   300 ---------------HEVEGT-------------------HHVHLNEPEKVAPIINSFI 324
                           .:|.|.                   |.|.:..|.:.|.:|..||
Zfish   271 IITPLQVIWGKQDQVVDVSGAAVIAETLPGCRVDLLENCGHSVVMERPRQTAKLIFDFI 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7632NP_649302.1 MhpC 57..326 CDD:223669 64/314 (20%)
abhd6bNP_001315288.1 MhpC 56..329 CDD:223669 63/317 (20%)
Abhydrolase 76..>173 CDD:304388 28/106 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1285824at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.