DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7632 and abhd11

DIOPT Version :9

Sequence 1:NP_649302.1 Gene:CG7632 / 40357 FlyBaseID:FBgn0037071 Length:330 Species:Drosophila melanogaster
Sequence 2:NP_001004290.1 Gene:abhd11 / 446169 ZFINID:ZDB-GENE-040909-1 Length:317 Species:Danio rerio


Alignment Length:287 Identity:64/287 - (22%)
Similarity:110/287 - (38%) Gaps:53/287 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 PIVGMHGWQDNAGTFDTLAPLLPSHL--SFLSIDAPGHGLSSWLPPGTSYHSI--DLVLITRRLM 118
            |:|.:||...:...|.::|..|....  ..|:|||..||.|...|..| |.::  ||.    .|:
Zfish    69 PLVFLHGLFGSKSNFHSIAKSLVQRTGRKVLTIDARNHGKSPHSPVLT-YDTMTSDLT----HLL 128

  Fly   119 EEYNWDKISILAHSMSSINGFVFSALFPDKVDLFVGLDVLKPPVRSARGIVDSLTERIESALKLE 183
            .:.:..|..::.|||........:...|:.|:..|.:|: .|.:.||.       ....:.::..
Zfish   129 GQLHIGKCVLIGHSMGGKVAMTTALSQPNLVERLVVVDI-SPSLTSAH-------TNFHAYIQAM 185

  Fly   184 RRLKSGSEPPAYDWDQLVTRLHEGS-NKSVSIDACKYLLQRNCKPSTHEPHKYYFSR------DN 241
            :.:|..|:.|.    ....||.|.. .|.|...:.:..|..|.:    |.:..|..|      .|
Zfish   186 KEVKIPSDIPR----STARRLAEDQLRKIVKERSVRQFLLTNLE----EQNGQYGWRINLESISN 242

  Fly   242 RLKSSLFYTLHQEVPMEMARRIKCPHLFIKALQAPYYERKEYFDEVLAELQKNPLFEYHEV---- 302
            .|:..|.:.       |.....:.|.||:....:.|....:|     .|:|:  ||...::    
Zfish   243 HLEDILGFP-------EFDTTYEGPTLFLGGSSSAYISSDDY-----PEIQR--LFPCADIQYIP 293

  Fly   303 EGTHHVHLNEPEKVAPIINSFINRYRP 329
            :.:|.:|.::|   ...|:|.|...:|
Zfish   294 DASHWIHADKP---LDFISSIITFLQP 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7632NP_649302.1 MhpC 57..326 CDD:223669 63/282 (22%)
abhd11NP_001004290.1 PRK10673 66..315 CDD:182637 63/283 (22%)
Abhydrolase 70..>157 CDD:304388 23/91 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.