DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7632 and abhd14b

DIOPT Version :9

Sequence 1:NP_649302.1 Gene:CG7632 / 40357 FlyBaseID:FBgn0037071 Length:330 Species:Drosophila melanogaster
Sequence 2:NP_956661.1 Gene:abhd14b / 393338 ZFINID:ZDB-GENE-040426-1342 Length:213 Species:Danio rerio


Alignment Length:105 Identity:26/105 - (24%)
Similarity:42/105 - (40%) Gaps:20/105 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 MHG-------WQDNAGTFDTLAPLLPSHLSFLSIDAPGHGLSSWLPPGTSYHSIDLVLITRRLME 119
            :||       || ..||.:|||   .:....|:||.||.|.|.......:...:...:..|::.|
Zfish    40 LHGIRFSSKNWQ-KIGTLETLA---AAGYRALAIDLPGLGQSKAAVAPAAVGELAPAVFLRQVCE 100

  Fly   120 EYNWDKISILAHSMSSINGFVFSALFPDKVDLFVGLDVLK 159
            ......:.|::.|:|.:....|         ||...::||
Zfish   101 GLQTGPVVIISPSLSGMYSLPF---------LFQHSELLK 131

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7632NP_649302.1 MhpC 57..326 CDD:223669 26/105 (25%)
abhd14bNP_956661.1 MhpC 23..212 CDD:223669 26/105 (25%)
Abhydrolase_5 37..191 CDD:289465 26/105 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170575117
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.