DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7632 and CG15879

DIOPT Version :9

Sequence 1:NP_649302.1 Gene:CG7632 / 40357 FlyBaseID:FBgn0037071 Length:330 Species:Drosophila melanogaster
Sequence 2:NP_647694.1 Gene:CG15879 / 38274 FlyBaseID:FBgn0035309 Length:342 Species:Drosophila melanogaster


Alignment Length:306 Identity:129/306 - (42%)
Similarity:184/306 - (60%) Gaps:17/306 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 FDEISIPVPWGHISGKWYGPKHVRPIVGMHGWQDNAGTFDTLAPLLPSHLSFLSIDAPGHGLSSW 98
            |.|:.||.|||||||:|||.:..|||:.:|||.||.||||.|.||||.::..|.||.||||.|:.
  Fly     6 FKEVRIPAPWGHISGRWYGNRTERPILAIHGWLDNLGTFDRLIPLLPDYIGVLCIDLPGHGRSAH 70

  Fly    99 LPPGTSYHSIDLVLITRRLMEEYNWDKISILAHSMSSINGFVFSALFPDKVDLFVGLDVLKPPVR 163
            :.||..|...|.|||..|:|:||.|.|:|::.||:..|..||:::|.||.||:.:.||:|.|..:
  Fly    71 IQPGMHYAVNDYVLIIPRVMKEYGWSKVSLMGHSLGGIISFVYTSLAPDTVDMVISLDILLPLSK 135

  Fly   164 SARGIVDSLTERIESALKLERRLKSGS--EPPAYDWDQLVTRLHEGSNKSVSIDACKYLLQRNCK 226
            ..:.::..|...::..|..|.|...|:  |||:|...||...|.:||:.||:.:..::||.|...
  Fly   136 DPKTVIKYLNHSLDKHLVEEERQVEGNLHEPPSYTLAQLTQVLAKGSDNSVTPEFAQHLLHRQVS 200

  Fly   227 PSTHEPHKYYFSRDNRLKSSLFYTLHQEVP------MEMARRIKCPHLFIKALQAPYYERKEYFD 285
            .|...|.:::||||.|:|   :|:..|..|      ::..|||.|  |.||..::.:.|.:.  :
  Fly   201 KSQLYPDRFFFSRDGRVK---YYSHLQMEPEFGEALVKRIRRIPC--LIIKGSKSDFVEART--E 258

  Fly   286 EVLAEL-QKNPLFEYHEVE-GTHHVHLNEPEKVAPIINSFINRYRP 329
            :.:|.| |.||.||::||| |||||||:..|:.|..|..||..:||
  Fly   259 KAVAILRQNNPHFEFYEVEGGTHHVHLHAAEECARYIVPFIRHHRP 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7632NP_649302.1 MhpC 57..326 CDD:223669 113/278 (41%)
CG15879NP_647694.1 MhpC 29..302 CDD:223669 113/279 (41%)
Abhydrolase 47..>109 CDD:304388 29/61 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45448338
Domainoid 1 1.000 120 1.000 Domainoid score I5749
eggNOG 1 0.900 - - E2759_KOG1454
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 52 1.000 Inparanoid score I2617
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D109693at6656
OrthoFinder 1 1.000 - - FOG0001238
OrthoInspector 1 1.000 - - otm42436
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR43329
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X774
109.900

Return to query results.
Submit another query.