DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7632 and Bphl

DIOPT Version :9

Sequence 1:NP_649302.1 Gene:CG7632 / 40357 FlyBaseID:FBgn0037071 Length:330 Species:Drosophila melanogaster
Sequence 2:NP_001032283.1 Gene:Bphl / 361239 RGDID:1307572 Length:291 Species:Rattus norvegicus


Alignment Length:297 Identity:56/297 - (18%)
Similarity:99/297 - (33%) Gaps:89/297 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 GPKHVRPIVGMHGWQDNAGTFDTLAPLLPS----HLSFLSIDAPGHGLSSWLPPGTSY------- 105
            |...|..:.||.|    :|..| .||.|.|    ..:.::.|..|:|.|.  ||...:       
  Rat    59 GEHAVLLLPGMLG----SGKTD-FAPQLQSLNKKRFTLVAWDPRGYGESR--PPDRDFPRDFFER 116

  Fly   106 ---HSIDLVLITRRLMEEYNWDKISILAHSMSSINGFVFSALFPDKVDLFVGLDVLKPPVRSARG 167
               .::|       ||:...:.::|:|..|...|...:.:|.:|..:...|        :..|..
  Rat   117 DAKDAVD-------LMKALQFKQVSLLGWSDGGITALIAAAKYPSYIRKMV--------IWGANA 166

  Fly   168 IVDSLTERIESALKLERRLKSGSEPP---AYDWDQLVTRLH---EGSNKSVSI---DACKYLLQR 223
            .|.....||...::...:....:..|   .|..|.......   :|.|:...:   :.|::||  
  Rat   167 YVTEEDSRIYQGIRDVSKWSEKARKPLEALYGHDYFAKTCEKWVDGINQFKHLPDGNICRHLL-- 229

  Fly   224 NCKPSTHEPHKYYFSRDNRLKSSLFYTLHQEVPMEMARRIKCPHLFIKALQAPYYERKEYFDEVL 288
                                            |:     |:||.|.:...:.|...|  :..:.|
  Rat   230 --------------------------------PL-----IQCPTLIVHGEKDPLVPR--FHADFL 255

  Fly   289 AELQKNPLFEYHEV-EGTHHVHLNEPEKVAPIINSFI 324
            .|..|..  ..|.: ||.|::||...::...::..|:
  Rat   256 LEHVKGS--RLHLMPEGKHNLHLRFADEFNRLVEDFL 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7632NP_649302.1 MhpC 57..326 CDD:223669 54/292 (18%)
BphlNP_001032283.1 MhpC 44..291 CDD:223669 56/297 (19%)
Abhydrolase 58..259 CDD:304388 48/262 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.