DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7632 and Abhd11

DIOPT Version :9

Sequence 1:NP_649302.1 Gene:CG7632 / 40357 FlyBaseID:FBgn0037071 Length:330 Species:Drosophila melanogaster
Sequence 2:NP_001258109.1 Gene:Abhd11 / 360831 RGDID:1304681 Length:307 Species:Rattus norvegicus


Alignment Length:336 Identity:63/336 - (18%)
Similarity:114/336 - (33%) Gaps:102/336 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 SIPVPWGHISGKWYGPKHVRP----------------IVGMHGWQDNAGTFDTLAPLLPSHLS-- 84
            ::||.:........|....||                ||.:||...:...|::||..|.....  
  Rat    24 AVPVTFSSSRSSGQGNADPRPLPLSYNLLDGDATLPAIVLLHGLFGSKSNFNSLAKALVQRTGRR 88

  Fly    85 FLSIDAPGHGLSSWLPPGTSYHSIDLVLITRRLMEEYNWDKISILAHSMSSINGFVFSALFPDKV 149
            .|::||..|| .|...|..||.::...|  :.|:.:.......::.|||......:.:...||.|
  Rat    89 VLTVDARNHG-DSPHSPDASYEAMSQDL--QGLLPQLGLVPSVLVGHSMGGKTAMLLALQRPDVV 150

  Fly   150 DLFVGLDV-----------------LKP-------PVRSARGIVDSLTERIESALKLERRLKSGS 190
            :..|.:|:                 :|.       |...||.:.|   |::.|.:| |..::   
  Rat   151 ERLVVVDISPAGTTPGSYLGNFIAAMKAVDIPENIPHSRARKLAD---EQLSSVVK-EASVR--- 208

  Fly   191 EPPAYDWDQLVTRLHEGSNK---SVSIDACKYLLQRNCKPSTHEPHKYYFSRDNRLKSSLFYTLH 252
                   ..|:|.|.|.:.:   .|::||....|.:                        ..|..
  Rat   209 -------QFLLTNLVEVNGRFSWRVNLDALAQQLDK------------------------ILTFP 242

  Fly   253 QEVPMEMARRIKCPHLFIKALQAPYYERKEYFDEVLAELQKNPLFEYHEVE----GTHHVHLNEP 313
            |::.......     ||:....:||.....:     :.:::  ||...:::    ..|.||.::|
  Rat   243 QQLESYPGST-----LFLLGGNSPYVPPSHH-----SAIRR--LFPQTQIQTVPNAGHWVHSDKP 295

  Fly   314 EKVAPIINSFI 324
            :.....:.||:
  Rat   296 QDFMDAVISFL 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7632NP_649302.1 MhpC 57..326 CDD:223669 60/317 (19%)
Abhd11NP_001258109.1 Abhydrolase_5 60..195 CDD:289465 31/137 (23%)
PRK10673 61..307 CDD:182637 58/299 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.