DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7632 and Abhd8

DIOPT Version :9

Sequence 1:NP_649302.1 Gene:CG7632 / 40357 FlyBaseID:FBgn0037071 Length:330 Species:Drosophila melanogaster
Sequence 2:NP_001100771.1 Gene:Abhd8 / 306338 RGDID:1305693 Length:441 Species:Rattus norvegicus


Alignment Length:284 Identity:58/284 - (20%)
Similarity:97/284 - (34%) Gaps:69/284 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 MHG-------WQDNAGTF-----DTLAPLLPSHLSFLSIDAPGHGLSSWLPPGTSYHSIDLVLIT 114
            :||       |::....|     :.:||           |..|||.||......:|....|....
  Rat   173 IHGVGGSLAIWKEQLDFFVRLGYEVVAP-----------DLAGHGASSAPQVAAAYTFYALAEDM 226

  Fly   115 RRLMEEYNWDKISILAHSMSSINGFVFSAL----FPDKVDLFV-----GLDVLKPPVRSARGIVD 170
            |.:...|...:..::.||.    |..|...    :||.|...:     |...|:|.:.|...:..
  Rat   227 RAIFTRYAKKRNVLIGHSY----GVSFCTFLAHEYPDLVHKVIMINGGGPTALEPSLCSIFNMPT 287

  Fly   171 SLTERIESALKLERRLKSGSEPPAYDWDQLVTRLHEGSNKSVSIDACKYLLQRNCKPSTHEPHKY 235
            .:...:...|... .||:|.........||   |.||:..:||....:.::.....|...|.:  
  Rat   288 CVLHCLSPCLAWS-FLKAGFARQGAKEKQL---LKEGNAFNVSSFVLRAMMSGQYWPEGDEVY-- 346

  Fly   236 YFSRDNRLKSSLFYTLHQEVPMEMARRIKCPHLFIKALQAPYYERKEYFDEVLAELQKNPLFEYH 300
                            |.|:.:        |.|.:..:...:...:|  |:.:||:......:..
  Rat   347 ----------------HAELTV--------PVLLVHGMHDKFVPVEE--DQRMAEILLLAFLKLI 385

  Fly   301 EVEGTHHVHLNEPEKVAPIINSFI 324
            | ||:|.|.|..||.|..:::.|:
  Rat   386 E-EGSHMVMLECPETVNTLLHEFL 408

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7632NP_649302.1 MhpC 57..326 CDD:223669 58/284 (20%)
Abhd8NP_001100771.1 MhpC 149..408 CDD:223669 57/282 (20%)
Abhydrolase_5 168..390 CDD:289465 51/264 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166335840
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.