DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7632 and Abhd6

DIOPT Version :9

Sequence 1:NP_649302.1 Gene:CG7632 / 40357 FlyBaseID:FBgn0037071 Length:330 Species:Drosophila melanogaster
Sequence 2:NP_001007681.1 Gene:Abhd6 / 305795 RGDID:1359323 Length:337 Species:Rattus norvegicus


Alignment Length:301 Identity:64/301 - (21%)
Similarity:113/301 - (37%) Gaps:73/301 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 PKHVRPIVGMHGWQDNAGTFDTLAPLLPSHLSFLSIDAPGHGLSSWLPPGTSYHSID---LVLIT 114
            |.|...::.:||:..:...:.::...||.:|..:.:|.|||       .||:..|:|   :|...
  Rat    68 PGHKPSVLMLHGFSAHKDMWLSVVKFLPKNLHLVCVDMPGH-------EGTTRSSLDDLSIVGQV 125

  Fly   115 RRLME-----EYNWDKISILAHSMSSINGFVFSALFPDKVDLFVGLDVLKPPVRSARGIVDSLTE 174
            :|:.:     :.|.....::..||......|::|.:|..|   ..|.::.|     .|:..|...
  Rat   126 KRIHQFVECLKLNKKPFHLIGTSMGGNVAGVYAAYYPSDV---CSLSLVCP-----AGLQYSTDN 182

  Fly   175 RIESALKLERRLKSGSEPPAYDWDQLVTRLHEGSNKSVSIDACKY--------LLQRNCKPSTHE 231
            |      ..:|||...:..|.....|:....|  ..|..:..|.|        :||.  ......
  Rat   183 R------FVQRLKELEDSAATQKIPLIPSTPE--EMSEMLQLCSYVRFKVPQQILQG--LVDVRI 237

  Fly   232 PHKYYFSRDNRLKSSLF---------YTLHQEVPMEMARRIKCPHLFIKALQAPYYERKEYFD-- 285
            ||..::.:       ||         |:||:.:.     :||.|      .|..:.::.:..|  
  Rat   238 PHNSFYRK-------LFLEIVSEKSRYSLHENMD-----KIKVP------TQIIWGKQDQVLDVS 284

  Fly   286 --EVLAELQKNPLFEYHEVEGTHHVHLNEPEKVAPIINSFI 324
              ::||:...|...|..|..| |.|.:..|.|.|.::..|:
  Rat   285 GADILAKSITNSQVEVLENCG-HSVVMERPRKTAKLVVDFL 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7632NP_649302.1 MhpC 57..326 CDD:223669 62/297 (21%)
Abhd6NP_001007681.1 MhpC 51..327 CDD:223669 64/301 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1454
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1285824at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.