DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7632 and mest

DIOPT Version :9

Sequence 1:NP_649302.1 Gene:CG7632 / 40357 FlyBaseID:FBgn0037071 Length:330 Species:Drosophila melanogaster
Sequence 2:NP_571118.2 Gene:mest / 30242 ZFINID:ZDB-GENE-991111-5 Length:344 Species:Danio rerio


Alignment Length:254 Identity:46/254 - (18%)
Similarity:84/254 - (33%) Gaps:94/254 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   115 RRLMEEYNWDKISILAHSMSSI------------------NGFVFSALFPDKVDLFVGLDVLKPP 161
            ||:..|: |..:.:|...:.::                  :|..|:         |.|.|:.   
Zfish    16 RRVSREW-WLHVGLLCVPLLAVYLHIPPPQLSPALNSWRTSGHFFT---------FRGNDIF--- 67

  Fly   162 VRSARGIVDSLTERIESALKLERRLKSGSEPPAYDWDQLVTRLHEGSNKSVSIDACKYLLQRNCK 226
            .:.:.|:|.|....:         |..|....:|||.::...|.:..|:.:::|...:..  :.|
Zfish    68 YKESVGVVGSSDVLV---------LLHGFPTSSYDWYKIWDSLTQRFNRVIALDFLGFGF--SDK 121

  Fly   227 PSTHEPHKYYFSRDNRLKSSLFYTLHQEVPMEMARRIKC--PHLFIKALQAPYYERKEYFDEVLA 289
            |   .||:|          |:|         |.|..::.  .||.:...:...... :|.|.|..
Zfish   122 P---RPHRY----------SIF---------EQASVVEALVAHLGLSEQRINILSH-DYGDTVAL 163

  Fly   290 ELQKNPLFEY-HEVEG-----------------THHVH-----LNEPEKVAPIINSFIN 325
            ||    |:.. |...|                 |||..     |.:...::|::...:|
Zfish   164 EL----LYRSDHNRSGHIIVNSLCLSNGGIFPETHHPRFLQKVLKDSGFISPVLTRLMN 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7632NP_649302.1 MhpC 57..326 CDD:223669 46/254 (18%)
mestNP_571118.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170575069
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.