DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7632 and Abhd14a

DIOPT Version :9

Sequence 1:NP_649302.1 Gene:CG7632 / 40357 FlyBaseID:FBgn0037071 Length:330 Species:Drosophila melanogaster
Sequence 2:NP_001009670.1 Gene:Abhd14a / 300982 RGDID:1309721 Length:242 Species:Rattus norvegicus


Alignment Length:205 Identity:48/205 - (23%)
Similarity:76/205 - (37%) Gaps:56/205 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 HVRPIVGMHGWQDNAGTFDTLAPL-LPSHLSF--LSIDAPGHGLSSWLPP---GTSYHSIDL--- 110
            |...:|.:||...|:.|::.|..| |.|...:  :::|.||.|.|:  |.   .|....::|   
  Rat    64 HRAEVVFLHGKAFNSHTWEQLGTLQLLSKRGYRAVAVDLPGFGNSA--PSKEVSTESGRVELLEG 126

  Fly   111 ----------VLITRRLMEEYNWDKISILAHSMSSINGFVFSALFPDKVDLFV--GLDVLKPPVR 163
                      ||::..|...|   .:..|..|...:.|||  .:.|.....:.  ....:|.|..
  Rat   127 VLRDLQLQNTVLVSPSLSGSY---ALPFLMQSHHQLCGFV--PIAPTSTRNYAQEQFQAVKTPTL 186

  Fly   164 SARGIVDSLTERIESALKLERRLKSGSEPPAYDWDQLVTRLHEGSNKSVSIDACKYLLQRNCKPS 228
            ...|.:|....| ||..:| |.|.:.|          |.:||...:      || ||        
  Rat   187 ILYGELDHTLAR-ESLQQL-RHLPNHS----------VVKLHNAGH------AC-YL-------- 224

  Fly   229 THEPHKYYFS 238
             |:|..::.:
  Rat   225 -HKPEAFHLA 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7632NP_649302.1 MhpC 57..326 CDD:223669 47/203 (23%)
Abhd14aNP_001009670.1 MhpC 45..241 CDD:223669 48/205 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166335858
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.